CAZyme Information: MGYG000001665_00273

Basic Information

• Species: UMGS1322 sp900550765
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; UMGS1322; UMGS1322 sp900550765
• CAZyme ID: MGYG000001665_00273
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
711	MGYG000001665_9|CGC2	79605.68	4.9396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001665	2160920	MAG	United States	North America

• Gene Location: Start: 20863; End: 22998 Strand: +

Full Sequence      

MKPIEKEFSCVEALWFDENFAHKDGYNFQLNVEGDMHVFTEGNAFSYSSESLYTGSGTID
YGRAAGGKKDVTVNRTERGLQVIQHYEFFEGCCAVRQYNTVKNQGENPLPLIRVSSAYLN
IEADTGVMAWDDPRRFRLHWCKSAWAAEAQWKHGSFWDFGMAPARPVGNSMTGVAAFRSE
GSWSSGRYYPLVIVEDLEKGCSYFMEHEGGHTWELTVGKLGDTVTLECNSADINHDGWSV
TLAPGEEYTTTCAVYGMVQGGFEEAVRELTEYKRQTSHVGWKNGTAPVCFNCYMDCIFGE
PNVETLVPLIEAAAKAGCEVFCIDAGWFRPRNNANCLADCGDYIPDAERFGPGGLKGILD
LIRQKGMIPGLWFELEAVDDYTAGAKCSSNAMVRRNGTVLSGGRGIYDLCDETVRQHLFA
AVDRAYQLGMRYIKNDHNFSTGIGYGERGDCYNTESRKRMDAFYSFIMELYRRYPDLIIE
NCGSGAMRADHGTLSHFYLQSTSDQEYYFNYASIAAGSLAIMPPEKAGNWVYPYAVTVPE
AKELDAGGDASFLIQRNQDGEETIFNLVTGNIGTIYMAGRIEYADAYNFELIQEGVELFK
KNRAFIASSSAVYPLGAACMGKRGFIAAGLMNRERTEMLLAVWKIRCIEEDCCMIELGRY
FSGATHAEMIFPQKDTKCRYTYAPEAGRLTVKMEGSENMARLFRIRLSERN

Enzyme Prediction     

No EC number prediction in MGYG000001665_00273.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	64	533	7.3e-66	0.6497093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	9.41e-59	287	601	3	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	5.46e-27	272	531	27	287	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	1.53e-18	304	528	309	529	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	1.75e-04	314	367	33	80	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	0.004	76	150	111	175	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANE45334.1	2.55e-136	71	693	91	717
QJD82733.1	3.87e-135	80	708	98	735
BBH22033.1	8.09e-134	12	706	30	726
QTH40642.1	2.43e-131	80	708	98	735
QGQ93977.1	1.81e-127	79	691	96	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	6.98e-17	173	492	217	540	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	1.60e-16	173	492	217	540	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
3MI6_A	8.49e-13	233	504	276	549	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1UB44	3.82e-16	173	492	217	540	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P16551	5.91e-12	287	528	293	529	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001665_00273.