CAZyme Information: MGYG000001655_03148

Basic Information

• Species: Butyricimonas faecalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas faecalis
• CAZyme ID: MGYG000001655_03148
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240	MGYG000001655_63|CGC1	27311.45	7.1851

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001655	4030245	MAG	United States	North America

• Gene Location: Start: 4; End: 726 Strand: +

Full Sequence      

MDIIWLDGGWVAPENRDQDIKMDRIVEMARGYQPGLIVVDRWIGGKYENYRTPEQKIPEK
PWDYPWETCMTMANQWSYLPGDKYKSTRELVHYLVDIVSKGGNFLLNVGVDGNGEIPPEG
IKIMKEMGVWMKVNGEAIYETRPIAPYKEAKICYTKHKNNGKVYAIYLNDENEVNPPSQI
MLYSISPARGAKISLLGYKGNLSYKRVGNGVLVTLPPSFVKNPACEHAWTLCISGMNEKE

Enzyme Prediction     

No EC number prediction in MGYG000001655_03148.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	2	140	2.3e-46	0.38439306358381503

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	2.11e-54	2	136	195	333	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.64e-51	2	170	195	373	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	2.22e-23	2	150	166	331	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam16757	Fucosidase_C	2.72e-11	152	231	9	87	Alpha-L-fucosidase C-terminal domain. The C-terminal domain of Structure 1hl8 is constructed of eight anti-parallel-strands packed into two-sheets of five and three strands, respectively, forming a two-layer-sandwich containing a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO50063.1	3.92e-182	1	240	228	467
ASZ09523.1	2.81e-83	1	238	230	478
ACU64455.1	9.53e-83	1	236	232	484
QHS60762.1	9.53e-83	1	234	232	482
QJB41770.1	9.10e-82	1	216	230	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	1.00e-23	1	169	201	380	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
7DB5_A	3.45e-18	4	141	216	362	ChainA, Alpha-L-fucosidase [Vibrio sp. EJY3]
7LJJ_A	1.56e-17	63	228	323	503	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	1.56e-17	63	228	323	503	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
1HL8_A	4.29e-17	2	221	219	436	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99LJ1	5.15e-22	2	237	211	452	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
P17164	1.91e-21	2	237	221	462	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
C3YWU0	4.56e-21	2	236	208	448	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
Q6AYS4	8.97e-21	2	236	215	458	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q99KR8	1.24e-20	2	236	217	460	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001655_03148.