CAZyme Information: MGYG000001654_00276

Basic Information

• Species: UMGS856 sp900760305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS856; UMGS856 sp900760305
• CAZyme ID: MGYG000001654_00276
• CAZy Family: GH42
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620	MGYG000001654_8|CGC1	70051.28	5.0424

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001654	2698113	MAG	United States	North America

• Gene Location: Start: 5296; End: 7158 Strand: +

Full Sequence      

MKPEIVVCGIPFETPREAEALRYVKEHGFTSVQIYVHWRLFEPEKRGEFDWSFYDREIRA
LQQAGLKFVPFLPLGPKYTVPEWWLRDPNHRGLVCLEHGKESPVESIWNPAFRAEMERVM
AAFAAHYGPWNVLESVQPGICGDYGEAIFPVLGNWPGDYHTHQGFWCGGEDAAASFRAAM
QEKYGSIAELNRAWRAAYASFDEVRPFRRSRQPSRTAWLDMMDWYHGSMTEFSAFWMDLC
RRNFPGLPVYLCTGGTEPPEHGAHFGEQAAVAARYGGGIRLTNEGNNFFQNLQDTIHMHS
ACEFYGAYLGLEPVGPMQVAGVVNRIYGSAAYGNRQIFHYYDNLVDEEKQYNGAAEEIRK
YLPLIRERRTQAGITLFWPMDEAFLDGTRIPENLLLTLEALRKSYEVRVADERMILDGAL
EGTRLLVMLDAGCARAEALHKIADWVAGGGVLLCNRHVLNTELDPDPAFDAVFGIEGAEE
AWGHTEYRAHPADWTAAFSQIDRVHSSVGWRDLAASCRPLLQCEESDPPDAGVIIRPCMA
AFTHPFGKGLGIFYAAPLDLNTPEDAIMGRSPAFRYLLADCCRAYGGVEPMELAEGDIVR
TRIDGRTLVLRDRQIEWLDN

Enzyme Prediction     

No EC number prediction in MGYG000001654_00276.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	18	253	3.7e-21	0.6037735849056604

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01373	Glyco_hydro_14	8.52e-18	21	246	22	266	Glycosyl hydrolase family 14. This family are beta amylases.
pfam02449	Glyco_hydro_42	5.86e-13	8	249	1	233	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	3.94e-12	11	479	24	521	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam01301	Glyco_hydro_35	3.48e-05	11	87	18	102	Glycosyl hydrolases family 35.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK00301.1	4.04e-257	4	604	3	605
CCW35746.1	1.80e-36	21	487	221	711
AOH55020.1	4.55e-18	21	244	56	298
QNK47161.1	4.35e-17	21	284	52	337
QYF80636.1	4.35e-17	21	284	52	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KWG_A	3.16e-12	7	246	4	235	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
3VOC_A	3.18e-11	21	247	27	271	Crystalstructure of the catalytic domain of beta-amylase from paenibacillus polymyxa [Paenibacillus polymyxa]
1VEP_A	9.66e-11	21	244	35	276	ChainA, Beta-amylase [Bacillus cereus]
1VEN_A	1.28e-10	21	244	35	276	ChainA, Beta-amylase [Bacillus cereus]
1B90_A	2.23e-10	21	244	35	276	BacillusCereus Beta-Amylase Apo Form [Bacillus cereus],1B9Z_A Bacillus Cereus Beta-Amylase Complexed With Maltose [Bacillus cereus],1J0Y_A Beta-amylase from Bacillus cereus var. mycoides in complex with glucose [Bacillus cereus],1J0Y_B Beta-amylase from Bacillus cereus var. mycoides in complex with glucose [Bacillus cereus],1J0Y_C Beta-amylase from Bacillus cereus var. mycoides in complex with glucose [Bacillus cereus],1J0Y_D Beta-amylase from Bacillus cereus var. mycoides in complex with glucose [Bacillus cereus],1J0Z_A Beta-amylase from Bacillus cereus var. mycoides in complex with maltose [Bacillus cereus],1J0Z_B Beta-amylase from Bacillus cereus var. mycoides in complex with maltose [Bacillus cereus],1J0Z_C Beta-amylase from Bacillus cereus var. mycoides in complex with maltose [Bacillus cereus],1J0Z_D Beta-amylase from Bacillus cereus var. mycoides in complex with maltose [Bacillus cereus],1J10_A beta-amylase from Bacillus cereus var. mycoides in complex with GGX [Bacillus cereus],1J10_B beta-amylase from Bacillus cereus var. mycoides in complex with GGX [Bacillus cereus],1J10_C beta-amylase from Bacillus cereus var. mycoides in complex with GGX [Bacillus cereus],1J10_D beta-amylase from Bacillus cereus var. mycoides in complex with GGX [Bacillus cereus],1J11_A beta-amylase from Bacillus cereus var. mycoides in complex with alpha-EPG [Bacillus cereus],1J11_B beta-amylase from Bacillus cereus var. mycoides in complex with alpha-EPG [Bacillus cereus],1J11_C beta-amylase from Bacillus cereus var. mycoides in complex with alpha-EPG [Bacillus cereus],1J11_D beta-amylase from Bacillus cereus var. mycoides in complex with alpha-EPG [Bacillus cereus],1J12_A Beta-Amylase from Bacillus cereus var. mycoides in Complex with alpha-EBG [Bacillus cereus],1J12_B Beta-Amylase from Bacillus cereus var. mycoides in Complex with alpha-EBG [Bacillus cereus],1J12_C Beta-Amylase from Bacillus cereus var. mycoides in Complex with alpha-EBG [Bacillus cereus],1J12_D Beta-Amylase from Bacillus cereus var. mycoides in Complex with alpha-EBG [Bacillus cereus],1J18_A Crystal Structure of a Beta-Amylase from Bacillus cereus var. mycoides Cocrystallized with Maltose [Bacillus cereus],1VEM_A Crystal Structure Analysis of Bacillus Cereus Beta-Amylase at the optimum pH (6.5) [Bacillus cereus],5BCA_A Beta-Amylase From Bacillus Cereus Var. Mycoides [Bacillus cereus],5BCA_B Beta-Amylase From Bacillus Cereus Var. Mycoides [Bacillus cereus],5BCA_C Beta-Amylase From Bacillus Cereus Var. Mycoides [Bacillus cereus],5BCA_D Beta-Amylase From Bacillus Cereus Var. Mycoides [Bacillus cereus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O69315	1.73e-11	7	246	4	235	Beta-galactosidase OS=Thermus thermophilus OX=274 PE=1 SV=1
Q9X6C6	2.28e-11	7	246	4	235	Beta-galactosidase BgaT OS=Thermus brockianus OX=56956 GN=bgaT PE=1 SV=1
P96513	3.59e-10	21	247	62	306	Beta-amylase (Fragment) OS=Cytobacillus firmus OX=1399 PE=3 SV=1
P21543	3.64e-10	21	247	62	306	Beta/alpha-amylase OS=Paenibacillus polymyxa OX=1406 PE=1 SV=1
P19584	4.26e-10	24	206	62	256	Thermophilic beta-amylase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001654_00276.