CAZyme Information: MGYG000001651_01476

Basic Information

• Species: UBA1191 sp900545775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; UBA1191; UBA1191 sp900545775
• CAZyme ID: MGYG000001651_01476
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000001651_22|CGC1	40980.73	5.2426

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001651	2137592	MAG	United States	North America

• Gene Location: Start: 28454; End: 29581 Strand: +

Full Sequence      

MKRIFSVTISFALILLAVFLIVLKLHDPAYITLNDIRSAGQTAYIEQKLDEMSLEEKIGQ
MFMGCFYNGTPSPETVSRYHLGSVLLFHSSFAEKDKASVISQLKAINDICNIKPIIAVDE
EGGTVNRISNSPSFRSEPFKSPREIFASGGMDAIIKDTHDKNAFLSELGINLNLAPVCDI
SQDPKDFMFSRSLGQNAQITSQYAAAVTKASLEDNIGCCLKHFPGYGNSADTHKGMSIDK
RSEKQLEENDFLPFKAGIDAGAPSVLVSHNIVSSLDESLPASLSPAVHRILRYDMNFSGV
IITDDLSMGAVSNFSPKTDSAVTAIMAGNDILCTGDFASQYKAVLEAVNNGTISEERIDT
SVRRILLWKKDLSLF

Enzyme Prediction     

No EC number prediction in MGYG000001651_01476.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	333	3.2e-45	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	2.13e-67	53	366	1	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	1.37e-56	52	375	1	318	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	7.68e-29	82	347	27	272	beta-hexosaminidase; Provisional
PRK15098	PRK15098	3.68e-22	1	375	1	359	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW43722.1	1.39e-109	46	374	60	387
BCI61427.1	5.19e-108	45	374	153	481
QHQ63470.1	9.06e-107	46	374	86	413
SET88834.1	1.50e-105	25	374	70	416
QNM02560.1	2.73e-105	45	374	85	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	5.84e-42	52	370	11	338	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.06e-38	47	369	37	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.19e-38	47	369	11	367	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	5.30e-38	47	369	41	397	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	5.86e-33	53	365	8	333	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	5.79e-38	47	369	37	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	7.75e-28	74	372	57	383	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q82SJ8	1.11e-26	69	332	12	280	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1
L7N6B0	3.15e-24	37	369	47	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
B2FPW9	3.94e-24	81	310	24	253	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.861401	0.136281	0.001166	0.000229	0.000159	0.000770

TMHMM  Annotations     

start	end
5	23