CAZyme Information: MGYG000001648_00765

Basic Information

• Species: CAG-594 sp900759985
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-594; CAG-594 sp900759985
• CAZyme ID: MGYG000001648_00765
• CAZy Family: CBM50
• CAZyme Description: Cell division suppressor protein YneA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317		34521.16	8.9858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001648	1268160	MAG	United States	North America

• Gene Location: Start: 136296; End: 137249 Strand: +

Full Sequence      

MNLDSPLKEGSTGNEVTILQQKLKILGYYTPTVTGSFGPDTTLAVRTFQEENGLLVTGIV
NTETWNTIFALTPSPFPTKRVLRPVLKRGSTGEDVKTLQRNLTQLMFYDGAIDGKFGVET
ENAVKAFQANNRLTADGIVGPDTWSALTYLYAPLAICGNESKPPTPPADNGNYVVKQGDT
LYSIAKKNNTTVDAIKSANGLTNNIISVGQKLIIPKDSTEPNYADYVVQKGDTLYAIANR
YDITVNDIMKLNNLNSTTISIGQELKIPNTNVTIYTVKKGDTLYSIAKANNTTVTSIKQL
NNLTSDTLSIGQQLKIR

Enzyme Prediction     

No EC number prediction in MGYG000001648_00765.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	226	268	1.6e-16	0.975
CBM50	173	215	2.9e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	4.92e-29	159	317	393	592	1,4-beta-N-acetylmuramoylhydrolase.
COG3409	PGRP	6.58e-29	3	148	35	184	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	2.79e-27	173	316	333	523	1,4-beta-N-acetylmuramoylhydrolase.
pfam01471	PG_binding_1	1.47e-20	91	147	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
pfam01471	PG_binding_1	6.12e-19	12	68	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB41573.1	3.50e-30	85	268	30	202
AZR72829.1	9.11e-29	86	272	32	207
ADI02383.1	1.20e-28	4	221	43	228
ACL69856.1	1.23e-27	81	269	7	184
ADL13320.1	1.48e-27	86	268	35	207

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TV7_A	8.58e-11	85	153	108	175	ChainA, Putative peptidoglycan-binding/hydrolysing protein [Clostridioides difficile 630],5TV7_B Chain B, Putative peptidoglycan-binding/hydrolysing protein [Clostridioides difficile 630]
4LPQ_A	1.17e-09	87	200	12	114	Crystalstructure of the L,D-transpeptidase (residues 123-326) from Xylanimonas cellulosilytica DSM 15894 [Xylanimonas cellulosilytica DSM 15894]
7RUM_A	2.68e-08	85	147	24	85	ChainA, Endolysin [Salmonella phage GEC_vB_GOT],7RUM_B Chain B, Endolysin [Salmonella phage GEC_vB_GOT]
3BKH_A	3.23e-08	85	153	11	79	ChainA, lytic transglycosylase [Pseudomonas phage phiKZ],3BKV_A Chain A, lytic transglycosylase [Pseudomonas phage phiKZ]
4UZ2_A	8.15e-08	224	273	3	52	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O07532	1.40e-15	167	270	23	138	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
L7N653	7.13e-14	44	175	59	194	N-acetylmuramoyl-L-alanine amidase CwlM OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cwlM PE=1 SV=1
P54421	8.77e-14	175	267	30	129	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O31852	1.79e-13	167	271	23	135	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
P36550	3.47e-13	7	150	196	358	N-acetylmuramoyl-L-alanine amidase CwlL OS=Bacillus licheniformis OX=1402 GN=cwlL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001648_00765.