CAZyme Information: MGYG000001645_01165

Basic Information

• Species: Eubacterium_G sp900550135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_G; Eubacterium_G sp900550135
• CAZyme ID: MGYG000001645_01165
• CAZy Family: CBM56
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838		91267.18	7.4073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001645	2556758	MAG	United States	North America

• Gene Location: Start: 8622; End: 11138 Strand: -

Full Sequence      

MKGKLRKVFAAVLAMALLVTGLSVGNVEQTKASTIGSSGDYTVTGEDVSSSVSKITFNAS
NYAKYAIIHYKVNEGAQQNVQMSGSNTKFEQSITGLKKGDKITCSFTYNKGGLQYDSSQM
TYIAGSASGSNTDSNIQAPFGLVVNSPRNNAISVVWGRGNIDSYNIYVDNNRIASSVHCG
YYEFDNIAAGTHTVSVTTVSGSRESVKTSLPVTVGGQSQVTTKPTTTTVAPTTTAEKGVV
YIYQDINYGGRVTALNEGRYNLAALQAKGFKNDDLSSLKVQNGYEAILYDDDNFQGESRR
ITADTAWIGSDFNDRTSSIIVQKKAVETPAPTTTVAPTTTEKTNTDTSIAKPFGMVVSNP
SAGTIGVVWGRGNINSYNVYIDGNKVASKVGCAYYTYSGYSQGTHTIAITTVSGNKESAK
ETMTVNVAQSGSGQAPATTKAPATTKPATTTPSTGIGTDVPQLDSSIPVRSDKMFLQLNN
KTNGKYKDSEIYWIVLGRNKNHEICYLDAQGNLVKASESLNTVTKNGRKCANIAHSMAEA
KYVYLPDIESGRMYLSYGEPVYVTFINGADGKVGYAGPDLNNASDPNSDVLFEFAEFTVT
NKEYWGNTTRVDFFSFPVVTRLVGQGGFDNRPGDYPTYDKTVGDIGTRDQIFNAWKNSAP
AAWKSLYDGKRIMAPCKTTFNEGRENGHYFDNYINEFWNKYSNETLVFRCDAGTFRGRVN
GDHMTFTKDGVGGTYTIYKPTTQDVLEGKGNFNRGNSTELVIEAQLCAAFNRGVATDPAN
YQNPSAYYKNGTYNYYSRFLHEHSVNNFSYGFCYDDVNDQSTLLHYTNPTALILDLKW

Enzyme Prediction     

No EC number prediction in MGYG000001645_01165.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH64	474	836	2.3e-100	0.9863760217983651
CBM56	30	128	1.1e-25	0.6163522012578616

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09214	GH64-like	5.22e-105	476	836	3	318	glycosyl hydrolase 64 family. This family is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain, and in the Salinispora tropica CNB-440, coagulation factor 5/8 C-terminal domain (FA58C) protein, they are positioned C-terminal of two FA58C domains which are proposed to function as cell surface-attached, carbohydrate-binding domain. This FA58C-containing protein has an internal peptide deletion (of approx. 44 residues) in the LPHase domain II.
pfam16483	Glyco_hydro_64	1.32e-94	476	836	5	370	Beta-1,3-glucanase. Family 64 glycoside hydrolases have beta-1,3-glucanase activity.
cd09216	GH64-LPHase-like	2.59e-52	482	836	6	352	glycoside hydrolase family 64: laminaripentaose-producing, beta-1,3-glucanase (LPHase)-like. This subfamily is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain.
cd09220	GH64-GluB-like	3.78e-43	543	833	68	365	glycoside hydrolase family 64: beta-1,3-glucanase B (GluB)-like. This subfamily is represented by GluB, beta-1,3-glucanase B , from Lysobacter enzymogenes Strain N4-7 and related bacterial and ascomycete proteins. GluB is a member of the glycoside hydrolase family 64 (GH64) involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. GluB possesses the conserved Glu and Asp residues required to cleave substrate beta-1,3-glucans. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Based on the structure of laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis, which belongs to the same family as GluB but to a different subfamily, this cd is a two-domain model. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain.
smart00247	XTALbg	3.74e-05	242	319	4	79	Beta/gamma crystallins. Beta/gamma crystallins

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI66982.1	1.28e-142	461	838	99	477
AJG99223.1	5.95e-109	37	838	25	589
CUU48451.1	6.33e-108	37	838	25	589
ABR34974.1	6.33e-108	37	838	25	589
QUF72014.1	6.33e-108	37	838	25	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H4E_A	2.02e-100	468	838	3	375	Crystalstructure of a beta-1,3-glucanase domain (GH64) from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052]
5H9X_A	1.60e-62	452	838	116	444	Crystalstructure of GH family 64 laminaripentaose-producing beta-1,3-glucanase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5H9Y_A	1.10e-61	452	838	116	444	Crystalstructure of GH family 64 laminaripentaose-producing beta-1,3-glucanase from Paenibacillus barengoltzii complexed with laminarihexaose. [Paenibacillus barengoltzii]
3GD0_A	8.27e-27	550	836	79	363	ChainA, Laminaripentaose-producing beta-1,3-guluase (LPHase) [Streptomyces matensis],3GD9_A Chain A, Laminaripentaose-producing beta-1,3-guluase (LPHase) [Streptomyces matensis]
3HZB_A	9.57e-18	239	321	2	84	Crystalstructure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_B Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_C Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_D Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_E Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_F Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_G Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_H Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22222	8.18e-22	543	836	105	394	Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans OX=1710 PE=1 SV=1
Q59146	1.92e-21	543	836	105	394	Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) OX=79671 GN=glcI PE=3 SV=1
P02967	3.47e-06	240	327	4	90	Development-specific protein S homolog OS=Myxococcus xanthus OX=34 GN=ops PE=3 SV=1
P02966	8.34e-06	240	321	4	84	Development-specific protein S OS=Myxococcus xanthus OX=34 GN=tps PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000365	0.998735	0.000305	0.000217	0.000185	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001645_01165.