CAZyme Information: MGYG000001637_01720

Basic Information

• Species: Agathobacter sp900543445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp900543445
• CAZyme ID: MGYG000001637_01720
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1672		182291.86	4.6971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001637	2652425	MAG	China	Asia

• Gene Location: Start: 56847; End: 61865 Strand: +

Full Sequence      

MRRKLKWGKTLLAIALAGAMSVTSVNVPSFAVFAAEQNEQEAQTRSMSYDGTTLTVRLQS
NDLVLSPGDGKQVRDIQFFYAVYDSMEAARNDDVGDFFGKTDGAHTPTVGVDGSYSYSCE
RAISKGQVVRYNFNVLYNNADGTDAGACAQTFEYYTYANDSESAEPVSETGITKLEVYDA
NNGPNIAYKDNSFAFCLPKVNGAPIEKDTLDTVKRGYVIEVKKGDAWVNIENSDSGIKYD
NKVAEENTWKYDYWTWEGGGAYVIMFNFKESKQIRFRSVERADVHVDYTLDYPETKDEVT
VTSLAFPQNEVDISSQGAYAIPFDSLIVNGGSEIKGSKLQKTDNRLKWYIDPKADGHFYE
LGKEGSGLIWEKNYGWDGAQPNGGFWFNPIKNTVIIKVELADNPSVYAEIKLVIDDSVSE
KGAEYDFTKDNSAYDYADPGKNKAGYDLVWSDEFDGNYGDAKVDSDTGLNLVNWSYQLGD
GSEVGNPGWGNNEKQSYTRNKKNIAVNEDLNADGHGDGMLRLTASYEADGYKNGSEGSKD
YTSARIRTTSRTNEALFTTTYGYIESRMALPATKGAWPAFWMLPQSTDIYGNWPVSGEID
IMETCGAFTDGANNKACGTLHWGAPEHVYKGSGYVDLKSDYNYFHTYAIDWEPGKITWYY
DGVAVNTLQNWESMISGSTDSLSYDAPFDMPFYILLNLAVDSGQFGGDVNRATFHDDINM
YVDYVRAYQKTKGYAESVDRTASDNAKTDWDEYEGVNQIADVTASSLDANGFASDNDSDA
SKWYLSYNANNTGGKATLDSFKDDSGKTWAKVGISEAGSQDYSVQLIGHYNAKAGYVYKV
SFDAYADGNMIGKSVSTDSKEWAGWSTNGIQSYELSSTPQHVAFTFEQKSDFEKCRIEFN
LGSKATGNVYISNVKVEIVNPESINGDAGRKPLSNGDVIYNGTFDQGSAHVGGWVAAEGT
SLSVPRYTTEKIADSDVSVVDTASTLNKFENLNNGGVKYYERRAQISSTSGAPCIYQPGI
ELKADGYTLNFDMYSKNATTVQAAIYSVTEDGKLGTKMLESPVVNYIAESGVKNYKWAFR
TPRALANAALVLTFGDGASVQIDNVSMIGNSQAEVADENPVNAATQWNANGADGGAATDA
GIENGVHKFTGIKSGSNWYSPQITSAQFKTLAGVKYKMTAKLKLEGTSNNKVSYIVQNQG
SWEVVQDRTEIDLTTLGEPDEDGFYTYTTTIQCPNATYNNVALNFGLGFSEATNATFYFK
DVTLELDKSDDSGSTSGDDMGETQTGIEINYVLGADDAVNADANPFYYTKGAGKIVLVAP
SREGYLFAGWTLAADSTDYITEVSTDADSITVYAHWTKRTDAQIPVIGKQPVAVKCNVGG
NATLRIDANASDNGNLSYQWYKNSAAKIKKATPIEGATESSYAVETSASGMTYYFCVVTN
TNDAVNGTRTATVTSDIVAVEVTAKTSEPDHSEPTKPADSVSPKDDTSSADADHKPAGTI
TGVKNSYTVKVGSKNFTLKAEGYGDITFASSNNKVASIDPKTGKVKVKGPGIVKITIKAS
GDDTHAAETKVITIKVAPKKTTVKSAKSKEARQLTIRWKRDAQVSGYEIQYSTSKNFKNA
KSVTVGKNKTTSKSIDNLKSGKKYYIRIRSYKTVGKTKLNGSWSKTDIATTK

Enzyme Prediction     

No EC number prediction in MGYG000001637_01720.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	450	728	2e-63	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	8.67e-69	450	728	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	3.86e-42	445	729	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd08024	GH16_CCF	4.24e-36	448	729	1	330	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd00413	Glyco_hydrolase_16	7.91e-28	452	728	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	5.14e-19	540	730	102	267	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK74620.1	0.0	415	1204	30	819
ADL35059.1	7.95e-304	421	1280	340	1202
QWC21218.1	5.33e-72	336	1111	13	738
QTC43864.1	5.97e-72	440	1111	230	853
APH06018.1	6.37e-72	446	1198	33	735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2HYK_A	7.21e-37	448	729	9	243	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
3ATG_A	2.86e-35	447	733	4	243	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
4CRQ_A	2.85e-33	446	730	3	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
4DFS_A	1.76e-32	431	729	2	263	Structureof the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],4DFS_B Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]
5WUT_A	1.90e-32	445	729	4	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23903	3.99e-39	227	730	203	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
P45798	6.01e-30	446	729	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	7.51e-30	448	708	22	244	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q27082	3.35e-26	446	729	25	253	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q9ZG90	1.44e-18	446	729	56	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000297	0.998879	0.000201	0.000255	0.000187	0.000161

TMHMM  Annotations     

start	end
12	34