CAZyme Information: MGYG000001631_03309

Basic Information

• Species: Bilophila sp900553145
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp900553145
• CAZyme ID: MGYG000001631_03309
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		41796.14	9.7846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001631	3785752	MAG	China	Asia

• Gene Location: Start: 299; End: 1423 Strand: -

Full Sequence      

MKTIWINAGEFSGDMQAAALLTALREREPELSAVGMGGPNLARAGQKNLFRVESLSVMGI
MEVLTALPRALHMLSQIKKEMARLRPDAVVLVDAPEFNFRVAKIAHGLGIPVYYFIPPKI
WAWRTGRVRFLQRYVKRLFCILPFEPAFYSQYGVQVDYIGNPLVDMVDWPKLEKIEPVKG
RIGLMPGSRHKEVEALLPEFGKAARILLRQGRDLAFHCLRAPNMSEEKLRALWPSDVPIA
FDAPEDRYTAMRRCECMLAASGTATLETALAGVPTIVSYRVAPFSALVGRLLIKVKWVSL
TNLIMQKELFPELLQERATGEMMASQLAAWLDIPPQIEGVRAELAELRRRCGEPGSASRA
AEKLLEAMGKNGNR

Enzyme Prediction     

No EC number prediction in MGYG000001631_03309.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	349	2e-110	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.12e-114	1	372	1	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.12e-111	1	366	1	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.54e-86	4	328	1	336	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.12e-73	3	366	7	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.50e-53	1	321	1	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABM28724.1	1.07e-160	3	368	4	369
AAS95839.1	1.52e-160	3	368	4	369
ADP86417.1	1.52e-160	3	368	4	369
CAJ55109.1	1.35e-150	1	366	1	366
AGC50489.1	1.35e-150	1	366	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.64e-50	3	366	8	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.11e-49	3	366	8	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.32e-79	4	368	7	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	2.84e-74	2	371	4	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q6ALW0	2.12e-71	4	368	12	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q39T49	7.94e-71	2	370	7	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1INL4	2.97e-70	1	368	1	374	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001631_03309.