CAZyme Information: MGYG000001631_02004

Basic Information

• Species: Bilophila sp900553145
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp900553145
• CAZyme ID: MGYG000001631_02004
• CAZy Family: GH102
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		67270.05	9.2818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001631	3785752	MAG	China	Asia

• Gene Location: Start: 100; End: 1989 Strand: -

Full Sequence      

MYIEKRPKRDAEDAYIQRGLGEGAGKKRRGREKRTEEKGRASVEDAPSLCLLRRGLFGDL
ERFSAHEPDEPFRRACGAPVAPCAGVFGHALGKQGLALGVHDIVHKDKGSPPDFAYPGVD
MDQIVIPGGPPVAALGFAYGQHDAEAFHLGVAHAHIADVLAAGTLEKVQVFCVIEVSHRV
GLSVGDAVGEPNIGSGKIVHEQHPLLKVPQKRGAGSAVLAAAVLALGLLAGCTASLPVPA
PSVPSRNVAGDLVPESDERAAMLAGKVDRAGQRLRSWKELAPALRASRAHIAGREPGQVA
VAHGDVAVTWGDVARTLDRLEALLPRLDAEPGLLAERFRWVKLKDGAAFSGYYEPVVKAS
RTRKPGYTAPLYRLPPDLQELNLGNFKTELIGQRIVYRLEKGKPVPYYTRAEIDGLDGKP
GVLRGRGLELAWLSDPVDAFFLQVQGSGRLRFEDGKEMPVRFAGSNGKPYLSIGGYLADQ
GEIPPGQVSMQSIRQWLRDHPGSRDDLLRRNQRYIFFRKGPESPSGSITSGPVGSMGSPL
SSMVSLAVDRTTFPLGSVLAFDVAIPDPSAPADKGPVPTMPLFGIGLAQDTGEAIKGRRV
DLFCGKGARAAYVAGHLNGPGEIWMLLAK

Enzyme Prediction     

No EC number prediction in MGYG000001631_02004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	357	518	5e-56	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03562	MltA	3.32e-85	277	518	6	231	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	4.46e-80	357	518	1	157	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
COG2821	MltA	1.70e-78	349	629	125	366	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
smart00925	MltA	8.83e-70	356	518	1	153	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
PRK11162	mltA	4.24e-50	349	626	118	354	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABM29113.1	2.83e-104	224	629	3	401
ADP85981.1	1.64e-103	241	629	62	424
AAS95367.1	1.64e-103	241	629	62	424
CAJ54777.1	9.50e-92	255	629	48	403
AGC50144.1	9.50e-92	255	629	48	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESJ_A	6.73e-52	350	629	103	360	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
6QK4_B	5.01e-45	350	626	104	344	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
2G5D_A	1.02e-40	350	627	119	412	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
2PNW_A	3.68e-39	350	629	99	364	Crystalstructure of membrane-bound lytic murein transglycosylase from Agrobacterium tumefaciens [Agrobacterium fabrum str. C58]
2G6G_A	2.94e-38	350	627	119	412	Crystalstructure of MltA from Neisseria gonorrhoeae [Neisseria gonorrhoeae FA 1090]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A935	2.26e-27	349	626	118	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	2.26e-27	349	626	118	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
Q9KPQ4	1.21e-25	329	626	93	349	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1
P57531	4.75e-25	350	629	119	359	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltA PE=3 SV=1
Q8K9A7	5.57e-21	350	626	127	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001631_02004.