CAZyme Information: MGYG000001631_00055

Basic Information

• Species: Bilophila sp900553145
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp900553145
• CAZyme ID: MGYG000001631_00055
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305		33260.13	6.6574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001631	3785752	MAG	China	Asia

• Gene Location: Start: 8489; End: 9406 Strand: +

Full Sequence      

MNQTTIQRVVTCSGIGLHSGNKVYLALRPASANTGIIFDIHTPDGIRRVSPAPKAVATTV
LATTLGSNDATVSTVEHLLASVLGLGIDNLIISVEGGEIPIMDGSAAAFLALFAEAGIHE
LPAPRKVMRISRPMELRDGNKYIRALPYAGFRVDCTIDFPHPTIGREHFSMEVTPESFTR
VANARTFGFFKDVEYLHSHGLARGGSLESVVVLDDNGVMNPEGLRYKDEFVRHKVLDFIG
DMAMLGMPIQGQFEICCSGHQLNNAFLRKAESERALQLIDLSLEEAQTRKTREKRPAYEG
SLALA

Enzyme Prediction     

No EC number prediction in MGYG000001631_00055.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	3	269	1.6e-104	0.985239852398524

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13186	lpxC	6.23e-149	1	286	2	289	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
pfam03331	LpxC	1.62e-143	3	269	1	268	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
COG0774	LpxC	5.28e-122	1	269	2	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
TIGR00325	lpxC	6.91e-108	1	269	1	270	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK13188	PRK13188	6.20e-81	1	269	3	297	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS97389.1	5.04e-120	1	305	1	308
ABM27472.1	5.04e-120	1	305	1	308
ADP87837.1	5.04e-120	1	305	1	308
CAJ54681.1	3.96e-111	1	304	1	303
AGC50045.1	3.96e-111	1	304	1	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N8C_A	2.83e-79	1	297	3	301	Crystalstructure of Pseudomonas aeruginosa LpxC complexed with inhibitor [Pseudomonas aeruginosa],5N8C_B Crystal structure of Pseudomonas aeruginosa LpxC complexed with inhibitor [Pseudomonas aeruginosa]
4MDT_A	4.14e-79	1	268	2	273	Structureof LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_B Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_C Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_D Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli]
3P3G_A	5.01e-79	1	268	2	273	CrystalStructure of the Escherichia coli LpxC/LPC-009 complex [Escherichia coli IHE3034],3PS1_A Crystal structure of the Escherichia Coli LPXC/LPC-011 complex [Escherichia coli IHE3034],3PS2_A Crystal structure of the Escherichia Coli LPXC/LPC-012 complex [Escherichia coli IHE3034],3PS3_A Crystal structure of the Escherichia Coli LPXC/LPC-053 complex [Escherichia coli IHE3034],4IS9_A Crystal Structure of the Escherichia coli LpxC/L-161,240 complex [Escherichia coli IHE3034],4IS9_B Crystal Structure of the Escherichia coli LpxC/L-161,240 complex [Escherichia coli IHE3034],4ISA_A Crystal Structure of the Escherichia coli LpxC/BB-78485 complex [Escherichia coli IHE3034]
4MQY_A	5.86e-79	1	268	2	273	CrystalStructure of the Escherichia coli LpxC/LPC-138 complex [Escherichia coli]
7K99_A	7.79e-79	1	297	2	300	CrystalStructure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K99_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K9A_A Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1],7K9A_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q727D8	1.01e-120	1	305	1	308	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=lpxC PE=3 SV=1
Q1MQP6	7.92e-112	1	304	1	303	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Lawsonia intracellularis (strain PHE/MN1-00) OX=363253 GN=lpxC PE=3 SV=1
Q30X16	1.34e-110	1	290	1	291	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20) OX=207559 GN=lpxC PE=3 SV=1
B0US73	1.35e-82	1	285	2	291	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Histophilus somni (strain 2336) OX=228400 GN=lpxC PE=3 SV=1
A6Q223	3.07e-82	1	273	1	272	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Nitratiruptor sp. (strain SB155-2) OX=387092 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000089	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001631_00055.