CAZyme Information: MGYG000001624_02838

Basic Information

• Species: Proteus cibarius
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus cibarius
• CAZyme ID: MGYG000001624_02838
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		43293.76	7.382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001624	3841359	MAG	China	Asia

• Gene Location: Start: 16522; End: 17688 Strand: -

Full Sequence      

MSGQLSTTQRPLVIGLVAGETSGDILGAGLIRALKQMHPNVRFVGVAGPLMQAEGCEAWY
EMEELAVMGIVEVLERLPRLLKIRKDLTQRFSELKPDVFVGIDAPDFNITLEGRLKQKGI
KTIHYVSPSVWAWRQKRVFKIGKATDLVLAFLPFEKSFYDKYQVPCRFIGHTMADAIALN
PDKKAAREHLGISEETPCLALLPGSRHAEVEMLSADFIKTAQLLKQQIPSLHIVVPLVNA
KRRAQFELIHQNVAPELEIQLLDGQAREAMTASDATLLASGTAALECMLTKCPMVVGYRM
KPFTFWLAKRLVKTPYVSLPNLLAGREIIKELLQEECEPSALAQQLLPLLTDEEKVRQLK
EIFLQLHSAIRCNADEQAANAVLELVEK

Enzyme Prediction     

No EC number prediction in MGYG000001624_02838.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	14	371	3.9e-143	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	7	385	2	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	11	388	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	11	388	1	377	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	9.76e-171	14	382	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.21e-55	16	333	231	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATM99607.1	1.14e-278	1	388	3	390
QQP26649.1	2.69e-277	1	388	3	390
QPB80642.1	2.69e-277	1	388	3	390
QIG05001.1	4.46e-276	1	388	3	390
QIF88732.1	1.81e-275	1	388	3	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	7.35e-210	7	387	2	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.01e-209	7	387	2	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7N8N4	7.30e-223	10	388	11	389	Lipid-A-disaccharide synthase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=lpxB PE=3 SV=1
Q8ZH55	8.83e-216	10	388	16	394	Lipid-A-disaccharide synthase OS=Yersinia pestis OX=632 GN=lpxB PE=3 SV=1
Q667K2	8.83e-216	10	388	16	394	Lipid-A-disaccharide synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=lpxB PE=3 SV=1
A8GID3	3.28e-215	10	387	4	381	Lipid-A-disaccharide synthase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lpxB PE=3 SV=1
B6HZF6	1.33e-214	7	387	2	382	Lipid-A-disaccharide synthase OS=Escherichia coli (strain SE11) OX=409438 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001624_02838.