CAZyme Information: MGYG000001620_00085

Basic Information

• Species: UMGS1907 sp900556165
• Lineage: Bacteria; Patescibacteria; Saccharimonadia; Saccharimonadales; Saccharimonadaceae; UMGS1907; UMGS1907 sp900556165
• CAZyme ID: MGYG000001620_00085
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000001620_3|CGC1	37453.55	9.7985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001620	606682	MAG	China	Asia

• Gene Location: Start: 20306; End: 21319 Strand: +

Full Sequence      

MNDSFGRNVKISKISSGKFRRYNHLTFFQHLTIPSVVFGNLADIFRNIAGVFQSFVKLFF
LRPDVIFCKGGFVCVPVGLSAWVLRIPIVIHDSDAHPGLANRIISKFAKKIATGAPLEFY
SYPKEISKYVGIPVLENFKKYTEKERNEFKQELGFSKEKPLIVITGGGLGAARLNNAIVA
QGEELSKNAQIVLISGVAQFEELKEKTKDFAKDFHLMSFISKDMWKFLASADLVVARAGA
TSNLELAALHKPTILVPNARLTGGHQLKNAKVYEKTNAVKIVSDDEIETDPKMLSDEIIQ
VLSSEKELKRMGEEFGKFAKPNAAKDVADMILDLANL

Enzyme Prediction     

No EC number prediction in MGYG000001620_00085.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	162	323	3.3e-36	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	5.14e-82	6	335	48	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	5.00e-77	5	330	45	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	3.96e-70	14	336	56	356	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	1.98e-47	7	290	49	313	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
pfam04101	Glyco_tran_28_C	2.60e-29	161	327	1	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA06770.1	1.34e-117	5	332	52	377
QCT41397.1	1.43e-117	5	332	54	379
QHU91099.1	1.33e-114	5	332	52	380
QJU06536.1	1.33e-114	5	332	52	380
QHU89285.1	1.89e-114	5	332	52	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	9.43e-23	37	331	74	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	3.00e-21	50	335	80	355	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	1.42e-20	62	335	96	354	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q812T8	1.52e-44	14	287	56	310	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=murG2 PE=3 SV=1
Q730T5	8.21e-44	14	287	56	310	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=murG2 PE=3 SV=1
Q97GY4	1.89e-43	8	310	52	333	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=murG PE=3 SV=1
Q6HDR3	4.43e-43	8	287	50	310	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=murG2 PE=3 SV=1
A0RIN0	4.43e-43	8	287	50	310	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 3 OS=Bacillus thuringiensis (strain Al Hakam) OX=412694 GN=murG3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999653	0.000340	0.000003	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001620_00085.