CAZyme Information: MGYG000001599_02829

Basic Information

• Species: Phocaeicola sp900544075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544075
• CAZyme ID: MGYG000001599_02829
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	MGYG000001599_39|CGC1	51927.73	4.3588

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001599	4213385	MAG	China	Asia

• Gene Location: Start: 7297; End: 8685 Strand: -

Full Sequence      

MKSNILSFSKTILSFCGGFMLLTSCDDGSLEDIYKGDSSGEYVSDVNWTDAANKSTETYI
KYFFENASGRDTFGGEIYWEKPNTPKTGEPTSSQGSGGWSQGHALDIVTDYYIRNAGNAE
IQAKIYNDVMKPFLPAFDEWNRTCGYGGADFWNNFYDDMEWMALACLRVYELTGDTDYYD
ALMKMWDHIKGAKNGYKGQGGLAWKTDLPASRMSCSNGPGCLLAMKLYQLTVKEAKEGWE
AEAEYYLNFAKEVYTWMTAYLCDISTGQVYDNLGINDDGTVGDPDKVALSYNQGTFMASA
LELYNATGVEDYLRNAVSFASYQVNHKMDSNYPVFSGEGGSGDNLLFRGIFVRYFLDLLK
QPTGEAYPEKTKNKFIAALRSCSDVLWVNGHPEGWYVWEYDWTKAPEFGNRNDNENRLTI
SLNAEVPGATLIEIRARYEDWVQGKETEKANWIGPNFAKGAE

Enzyme Prediction     

No EC number prediction in MGYG000001599_02829.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	51	407	7.4e-71	0.9162011173184358

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.58e-22	50	383	4	318	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	3.45e-22	99	407	46	328	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ55352.1	1.04e-293	1	462	1	462
SCV07928.1	1.04e-293	1	462	1	462
QUT32576.1	1.04e-293	1	462	1	462
QDM11364.1	1.04e-293	1	462	1	462
QUT78423.1	1.04e-293	1	462	1	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.20e-41	99	439	89	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.24e-40	99	439	90	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.30e-39	99	439	90	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	4.06e-28	48	439	3	341	ChainA, Lin0763 protein [Listeria innocua]
4BOK_A	3.53e-25	99	369	39	287	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000005	1.000067	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001599_02829.