CAZyme Information: MGYG000001591_03319

Basic Information

• Species: Parabacteroides timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides timonensis
• CAZyme ID: MGYG000001591_03319
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866	MGYG000001591_57|CGC2	99474.55	5.6999

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001591	5999279	MAG	China	Asia

• Gene Location: Start: 23569; End: 26169 Strand: -

Full Sequence      

MRYKTVISAVALAALATTSPALADGVAKQNIDKGWTFKQVRGNNWYPATVPGTVQTDLMD
NKIIEDPFYRLNERSIQWVDKEDWEYKTTLNVSADVFDKDNIELDFKGLDTYADVYLNDS
CILKADNMFREWSVPVKGLLKKDGNELRVYFHSPIKVDLPKFEALKFPVEAGNDQSENGG
IFDKKVSIFARKAGYHYGWDWGPRIVTSGIWRPAYLIGWNDARIDNIFYDQTSVTAKRAD
IKTSVQVIADKDGEVTLDIKADGIKTTWTKKAQVKKGINLIETNLTVNNPKLWWSHGLGE
AHLYPFTATIRMDNKVVDTHKTNLGLRSIRVINQPDKDGHTFYFELNGVPVFMKGANYIP
QDNFLPRVTAEQYEKTIKDAVDVNMNMLRVWGGGIYEEDLFYDLCDKYGILVWQDFMFAC
SVYPLTPELEDNIRQEAIDNVIRLRNHPSLAIWCGNNEIHTAWFNWGWMKKFDQYGVTEQ
LRNDTKKLFNTILADVVKEYDPEIFYWPSSPYGGDPDAKCESGKPNWNPNGDAHYWGVWQ
GVDSVSHFNKVRARFFSEYGFQSFPEYQSVLKYAPEERDHDIYSDVMMAHQRGGQIANSR
IENITLEEYRKPKDFPSTLYMSILLQGDAMKTAMEAHRRMMPYNMGSLYWQHNDCWPVAS
WSSRDYYGRWKAQHYFTKKAFRDILISPIAEDGQLNIWMISDRLKAVKGKLDIRVMDLKG
NILFEKKSNVTLPANTSKIQFSAPVESVLGGKQPNEVVVNARFIESGKEAEVISNNYFFT
RFKDIDFPKADIQMTSVPAGDGYDVTVESNVFARAVFLSIDDIDNFFSDNYFDLLPNEPV
TIHVTTQLDKATFDKQLKSQSIVDAY

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	28	768	3.9e-107	0.7207446808510638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.28e-117	34	854	18	795	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	2.24e-23	693	784	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	1.96e-20	789	864	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	2.94e-13	222	327	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	8.59e-11	207	458	194	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68488.1	0.0	28	866	30	865
QUT31677.1	0.0	14	866	5	856
QGT72566.1	0.0	14	866	16	867
QRM99606.1	0.0	14	866	16	867
CBK67275.1	0.0	14	866	5	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	1.91e-231	31	866	11	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.04e-231	31	866	13	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.10e-231	31	866	13	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	5.57e-231	31	866	11	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	2.44e-229	31	866	11	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	8.68e-122	31	735	9	723	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q0CCA0	1.87e-118	28	845	6	827	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1D911	7.50e-118	31	735	9	723	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	4.01e-117	31	735	9	723	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A2QYN2	1.49e-116	27	845	5	829	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000259	0.998952	0.000209	0.000196	0.000180	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001591_03319.