CAZyme Information: MGYG000001590_01042

Basic Information

• Species: Desulfovibrio sp900547595
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio sp900547595
• CAZyme ID: MGYG000001590_01042
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
969	MGYG000001590_28|CGC1	105959.92	7.0153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001590	2294085	MAG	China	Asia

• Gene Location: Start: 16813; End: 19722 Strand: -

Full Sequence      

MPSSPPPVPESSGARATLVLLHGGADPRASLAALAHADSRPLVTLLWPSGASPAVAAATR
ALGERLLREDALGAFDWHTVPTGHAWRQGANAALTAMARNGGRLPEFVLFLSSAVIPEGG
CLRAMTGRLAAEPDLAGVCPLLLAPARDGAPRRVRHLGSVFDSRRQIHALYEGIPATHPL
AQRRRRFQIALEDALMVRRSDLCAAGGFLPELGDLAPLDLCFRLGGGRAAFSSEPAALAT
LGDIHAGWRSAACWNSLVQRGRIPPDTARPDYHLHVRADGLDYGLTPWLEEGPRGDGLVP
RGESWTDAWLRWRQAPEPATLLRLLAASDAAELSRLVDHCRAFPCMLPHMFAWYAAQVRH
IEDFARNAHLPELEADAARWRRSRARFHHSLLRPGMRALAGAGLWACSLDAAPSSYDAWM
ELREPAFPAARVDAGGEWPEIAVLMPVWNPRPAHLAAALDSVLEQRYDRWQLCVADDAST
DPEIPELLRTYAARDARIRLITREENGHISRATNSALALADAPWAAFFDHDDLLAPTALE
ETAAVIAARPDVRLIYSDEDKIDDDGVRRTPIFKPDFDADLHSVGHLATYATDLLRAVGG
LRPGLEGSQDVDLSLRATEQLDPRAVAHIPRVLYHWRFHEGSTTGSLAAKPYVLEATRRA
HTESAGRRGQTVEGAASGRNNFFKLILGIPPRLRCSVILLADSGCAARPSPAALLKALAA
LATRMPVEFCWQPLAPEASRPRAWAEDILPLPRLLPLAGRHWSDACRAAAREARGDVLLF
LHAGLTPVLDCRPEQLVIQAARRDLAMVGGLVWQRGVLWNGGFAPDVTGLPFPLLRGASP
EELPVHCWGQFLLARHALGVARECMACRRELFLDALALDARMGSLAGVDYTLRQESAGRF
TLVSPWGHWALPEDAEHEPLTPEAEACFRARWDETVRRHGLRNPHLRAAPDYGWRLILEE
TSGQTPRMP

Enzyme Prediction     

No EC number prediction in MGYG000001590_01042.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	443	552	1.1e-22	0.6411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	4.00e-88	439	637	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd00761	Glyco_tranf_GTA_type	4.31e-24	443	557	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.41e-22	443	573	2	130	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	2.32e-21	443	644	2	201	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	2.47e-19	439	640	3	195	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD91499.1	0.0	6	956	6	955
VZH32410.1	1.86e-244	26	959	22	1006
SPD36650.1	1.66e-242	61	960	54	1007
ATD81057.1	1.77e-242	61	960	56	1009
VZH34252.1	4.78e-94	101	936	83	976

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.98e-59	439	959	366	891	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	4.47e-43	414	892	291	771	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71054	3.73e-10	439	620	5	192	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001590_01042.