CAZyme Information: MGYG000001571_04007

Basic Information

• Species: Lacrimispora sp000526575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp000526575
• CAZyme ID: MGYG000001571_04007
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000001571_50|CGC1	42181.32	5.4557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001571	4730558	MAG	United States	North America

• Gene Location: Start: 7735; End: 8847 Strand: +

Full Sequence      

MQKIDQNGIREKLNLVVDKLLNLDKTNDESIIEERSEAVGYFKRDFGIKEWDWPQGIGLY
GLMKLQKIQGNEDYKEFLVNWYKDNLEQGLPSRNINTTAPLLALVDLNESVKDREFEALC
LDWANWLMKCLPKTEEGGFQHVTSANGDRLGVRLNENEMWIDTLFMTVLFLNKMGLKYNR
QDWVDEAYHQVLMHIKYLYDKKTGLFYHGWTFNERNNFGGVFWCRGNSWFTLGILEYMDM
FKGTMNSGIRHFVTETYKAQVQALLKLQSKSGLWHTVLDAPDSYEEVSGSAAIAAGILKG
IKMGILDDTYLQCAYGAVKGILKNIDADGTVLHVSGGTGMGYDKEHYKNILIAPMAYGQS
LAILALCEAL

Enzyme Prediction     

No EC number prediction in MGYG000001571_04007.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	369	2.6e-100	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	9.84e-92	49	370	32	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.08e-83	50	370	26	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30792.1	6.68e-212	1	370	1	370
QHB24645.1	8.03e-212	1	370	6	375
QEI32150.1	8.03e-212	1	370	6	375
ACR73371.1	4.40e-208	2	370	19	387
ASN96412.1	1.03e-207	5	370	10	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	6.25e-81	51	370	65	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	6.93e-78	9	368	8	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	2.23e-75	51	370	66	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.03e-50	42	370	23	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
T2KPL9	1.15e-12	160	307	159	314	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001571_04007.