CAZyme Information: MGYG000001570_01544

Basic Information

• Species: UBA4871 sp014467055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA4871; UBA4871 sp014467055
• CAZyme ID: MGYG000001570_01544
• CAZy Family: CBM20
• CAZyme Description: Cyclomaltodextrin glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		28427.47	4.8722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001570	1608657	MAG	United States	North America

• Gene Location: Start: 862; End: 1686 Strand: -

Full Sequence      

MSNDVYVYEREFDGNVVVTAVNRNEGYGCNISGLFTDLPAGSYSDVMGGLLGGNSISVSS
SGAVSNFTLGAGASAVWQYKKAQASAPQIGNVDPMIGIAGNTVTITGRGFGSMAGSVTFG
TAQAQVKTWNDSMITATVPSVTPGKYGIQVTAASGAKSNSYAGYEVMTGTQVPVRFKVNN
ATTSYGTNVYLVGSVEELGNWDASKAIGPLFNNTASIASYPTWFCDVNVPAGTTINYKFI
KKDSSGNVTWESGNNHTTVTPSSGAATVTVDWQS

Enzyme Prediction     

No EC number prediction in MGYG000001570_01544.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM20	172	265	6.4e-30	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05807	CBM20_CGTase	8.78e-45	171	272	2	101	CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain. CGTase, also known as cyclodextrin glycosyltransferase and cyclodextrin glucanotransferase, catalyzes the formation of various cyclodextrins (alpha-1,4-glucans) from starch. CGTase has, in addition to its C-terminal CBM20 domain, an N-terminal catalytic domain belonging to glycosyl hydrolase family 13 and an IPT domain of unknown function. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
pfam00686	CBM_20	1.24e-36	172	270	1	95	Starch binding domain.
cd05467	CBM20	4.67e-31	174	272	2	96	The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
smart01065	CBM_2	4.97e-30	172	262	1	88	Starch binding domain.
cd05808	CBM20_alpha_amylase	4.44e-28	172	272	1	94	Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain. This domain is found in several bacterial and fungal alpha-amylases including the maltopentaose-forming amylases (G5-amylases). Most alpha-amylases have, in addition to the C-terminal CBM20 domain, an N-terminal catalytic domain belonging to glycosyl hydrolase family 13, which hydrolyzes internal alpha-1,4-glucosidic bonds in starch and related saccharides, yielding maltotriose and maltose. Two types of soluble substrates are used by alpha-amylases including long substrates (e.g. amylose) and short substrates (e.g. maltodextrins or maltooligosaccharides). The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18371.1	1.76e-185	1	274	458	731
CDZ24376.1	1.71e-137	1	272	460	731
AEF16669.1	3.35e-96	1	273	441	709
AJE25826.1	4.72e-96	1	273	441	709
AFK86353.1	1.31e-95	1	273	441	709

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1A47_A	2.01e-96	1	273	414	682	CGTASEFROM THERMOANAEROBACTERIUM THERMOSULFURIGENES EM1 IN COMPLEX WITH A MALTOHEXAOSE INHIBITOR [Thermoanaerobacterium thermosulfurigenes],1CIU_A Thermostable Cgtase From Thermoanaerobacterium Thermosulfurigenes Em1 At Ph 8.0. [Thermoanaerobacterium thermosulfurigenes]
3BMV_A	2.01e-96	1	273	414	682	ChainA, Cyclomaltodextrin glucanotransferase [Thermoanaerobacterium thermosulfurigenes],3BMW_A Chain A, Cyclomaltodextrin glucanotransferase [Thermoanaerobacterium thermosulfurigenes]
1CYG_A	8.84e-94	1	273	410	679	CyclodextrinGlucanotransferase (E.C.2.4.1.19) (Cgtase) [Geobacillus stearothermophilus]
1KCK_A	2.82e-93	1	273	414	685	ChainA, CYCLODEXTRIN GLYCOSYLTRANSFERASE [Niallia circulans]
1EO5_A	2.82e-93	1	273	414	685	ChainA, PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE) [Niallia circulans],1EO7_A Chain A, PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE) [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26827	2.04e-95	1	273	441	709	Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyA PE=1 SV=2
P31797	9.69e-93	1	273	441	710	Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus OX=1422 GN=cgt PE=1 SV=1
P43379	2.81e-92	1	273	441	712	Cyclomaltodextrin glucanotransferase OS=Niallia circulans OX=1397 GN=cgt PE=1 SV=1
P04830	1.12e-91	1	273	442	713	Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans OX=44252 GN=cgtM PE=1 SV=2
P17692	1.68e-90	1	273	441	712	Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain B1018) OX=1417 GN=cgt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999974	0.000076	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001570_01544.