CAZyme Information: MGYG000001554_00460

Basic Information

• Species: Corynebacterium phoceense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium phoceense
• CAZyme ID: MGYG000001554_00460
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		36672.3	7.5771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001554	2774100	Isolate	not provided	not provided

• Gene Location: Start: 471226; End: 472227 Strand: +

Full Sequence      

MLFTGLLSLAAPIATPIATAAPLDDLQHMSSQTANQLNRAAADLTAQVNEQLGAIPGSSQ
AQLPAAPAPRVGNAKPAPFFINGTGGQVFTQSTGRTRRYLIEMPTHYNPARPAPVIFGFD
GWRDSPENFRRYSRLNETGAAREAIRIYPESINHGWEGAPYAVVRPGEDLAFITQIIDEL
DRTYNVDRRRIYATGHSNGGGMTAVVACHLPHVFAGVAAVGGAYYDPVNMNCRNEAIPFL
IMHGTGDTMMFYHGGYRHNGAHFLDVDHLMSSYIKRNACAFPPRIENIPGGQRHVYACAK
EELQLITNSQNHTWNRTPDASQEVWNFLSRQRL

Enzyme Prediction     

No EC number prediction in MGYG000001554_00460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	91	305	4.9e-25	0.9515418502202643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3509	LpqC	1.47e-24	91	332	41	308	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
COG1506	DAP2	2.65e-12	94	253	375	575	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG4099	COG4099	7.56e-11	170	247	250	326	Predicted peptidase [General function prediction only].
TIGR01840	esterase_phb	5.55e-10	173	225	79	131	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
COG0400	YpfH	1.60e-08	168	247	74	157	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA72326.1	3.38e-22	94	330	42	268
QBZ61744.1	1.18e-21	68	329	21	267
ALO15718.1	3.83e-21	94	330	32	288
VBB80928.1	5.56e-20	94	329	41	266
CDP29168.1	1.47e-19	94	329	41	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WYD_A	1.24e-09	99	247	23	165	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7RWX8	2.67e-16	65	330	23	288	Feruloyl esterase D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=faeD-3.544 PE=1 SV=1
Q5B2G3	2.49e-15	97	279	43	211	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
A2QYU7	4.64e-15	97	300	43	236	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
A1CC33	5.70e-14	97	279	45	213	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-2 PE=3 SV=1
B8N7Z6	7.57e-14	97	255	43	198	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000464	0.998693	0.000214	0.000220	0.000205	0.000198

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001554_00460.