CAZyme Information: MGYG000001548_00918

Basic Information

• Species: Paenibacillus_A tuaregi
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A tuaregi
• CAZyme ID: MGYG000001548_00918
• CAZy Family: CBM21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254		28608.38	6.8757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001548	5663842	Isolate	not provided	not provided

• Gene Location: Start: 974884; End: 975648 Strand: -

Full Sequence      

MLRRMKKHLSSLAFLSILALTFAPSVFASDQPVQLISANLYAYKYGYVGFSGSVEVNNLN
YQKTVTIHYTPGNGQWYDTPASYQGPTDSSHEKWNFAISTYSGDTTNPQLQNAQNIQFAI
KYETGGQTYWDNNNGQNYSVSRYNMSSTILGGPNVLRAFDSLTQNTFAGGVFVKNLDYNK
TVKIEYTTDNWNTTKEGYATYYGPANSDSSVQEWHFSINNIDSGVSQIKYAISYTVNGQT
YWDNNYGSNYLVNR

Enzyme Prediction     

No EC number prediction in MGYG000001548_00918.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	161	252	2e-22	0.8785046728971962
CBM21	48	140	5.3e-21	0.8411214953271028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03370	CBM_21	7.82e-21	31	141	5	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
pfam03370	CBM_21	2.87e-18	150	253	2	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
pfam16760	CBM53	5.57e-05	175	250	1	73	Starch/carbohydrate-binding module (family 53).
pfam16760	CBM53	0.004	112	140	50	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ70729.1	1.80e-132	4	254	4	254
QQZ61948.1	2.55e-132	1	254	1	254
CQR53753.1	1.04e-131	1	254	1	254
QMV44549.1	4.13e-83	2	253	1	253
CQR52133.1	2.19e-78	2	253	1	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2DJM_A	3.99e-14	37	141	8	105	ChainA, glucoamylase A [Rhizopus arrhizus],2V8L_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_B Chain B, Glucoamylase A [Rhizopus arrhizus],2V8M_C Chain C, Glucoamylase A [Rhizopus arrhizus],2V8M_D Chain D, Glucoamylase A [Rhizopus arrhizus],2VQ4_A Chain A, GLUCOAMYLASE A [Rhizopus arrhizus],4BFN_A Chain A, Glucoamylase [Rhizopus arrhizus],4BFO_A Chain A, Glucoamylase [Rhizopus arrhizus]
2EEF_A	5.61e-10	162	254	43	137	ChainA, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]
2M83_A	4.81e-08	31	140	25	133	Solutionstructure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07683	1.43e-11	15	148	16	137	Glucoamylase 1 OS=Rhizopus oryzae OX=64495 PE=1 SV=2
A6QNP3	9.93e-09	162	254	139	233	Protein phosphatase 1 regulatory subunit 3B OS=Bos taurus OX=9913 GN=PPP1R3B PE=2 SV=1
P40187	1.26e-08	169	252	410	507	GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1
Q86XI6	1.35e-08	162	254	140	234	Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
Q0VCR4	2.88e-08	161	252	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000828	0.997860	0.000370	0.000350	0.000295	0.000252

TMHMM  Annotations     

start	end
9	28