CAZyme Information: MGYG000001544_00023

Basic Information

• Species: Corynebacterium bouchesdurhonense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium bouchesdurhonense
• CAZyme ID: MGYG000001544_00023
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		44541.51	6.4244

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001544	2255536	Isolate	not provided	not provided

• Gene Location: Start: 1522; End: 2724 Strand: +

Full Sequence      

MPETWSHRADLASSAIDERHAMRLWGIPKTNLAAATWPAGAKDKLFWHWHYWWQAQYLDC
QVDAASRRPTKSRKRRIADTLRGIQRRNRGKLTENQHYDDKAWLALAWNRALALEGSRRP
RALDALEFDLLAGIDPVTGVLPWRKGETFYNVPSNATAAIVFARTGRLDKARQIVDWIFD
NLVTESGLLFDGIRMRMNGPEVVEKIYTYNQGTVLGASLEIALALREDVGLGYTDQIDSF
EDSQRADDSVFYITHIRAIVQAVALHLANPQGVIVSPESESGEGDGGLFKGILARYLAEV
AVRLPADSRENIATKKVAARLVLASAESLWTHRLEVDGLPIFPAEWTEDARLPHNYGLGP
SSLSEAVGLLRIDERDLSVQLSGWLLLEAAARVAASDVLG

Enzyme Prediction     

No EC number prediction in MGYG000001544_00023.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	14	350	9.2e-70	0.8854748603351955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	3.19e-140	8	400	2	377	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	1.14e-15	50	320	33	315	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQQ16150.1	1.36e-252	1	397	1	397
AIL97573.1	8.67e-247	1	397	1	397
QQU84296.1	1.75e-246	1	396	1	396
AKV59622.1	1.01e-245	1	396	1	396
AOX04956.1	2.89e-237	3	397	7	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.22e-22	48	391	85	387	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.66e-21	48	391	86	388	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	1.66e-20	48	391	86	388	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	7.99e-16	5	393	3	340	ChainA, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001544_00023.