CAZyme Information: MGYG000001542_02523

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_02523
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594	MGYG000001542_34|CGC1	67201.84	5.0652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 7302; End: 9086 Strand: +

Full Sequence      

MKILINHIGYERKGTKRAVIMGSSTDEVSSFQVVDQSSGQMAYAGTVQCCGTVGKWRNWF
FWTADFDGLQVEGRYVIECDTTHGVIRSYDFAIEDHLLGKQSLSDVIFYLKAQRCSGDFD
RADRNIPFAGEREGRHDLHGGWYDATGDYGKHLSHLSHATYFNPQQGSFAAWVLFKAHEL
LEESGNRHYYQFKRRLLDEAMYGADYMFRMRAPSGSFFRSVRRSGEFMKAEDRSISFQYK
NSSSQFGAAATAEVEVITDESYETGFRQGAGFAIAALAAASRHAYPGDYSREQYLQAARE
SYEYLAENNAKYLNDGKPNLLDEYCRLIALVELYQASLDPDYLKQAGESAERLIGYIKPS
SEWGCYWSANEEGRPFFHASDAGLPVVALLNYLQIEKNPSRRSNIMEAALRVMESELKIT
GEVVNPFGLARQYVQSSDGRRYTSYFLPHQTEVSPWWQGENARLASLATAARLLSKQLTE
AKDTAFKERLLAYADAQLSWILGLNPFDSCMLQGSGRNNPQYHFVNGFDYMNCPGGICNG
ITSGLTDEEDIELFIKSEPGVVDDNWRWAEQWLPHASWYMYAVALGDLSDSEDQ

Enzyme Prediction     

No EC number prediction in MGYG000001542_02523.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	101	524	4e-42	0.854066985645933

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02850	E_set_Cellulase_N	1.31e-21	2	93	1	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam02927	CelD_N	4.46e-16	2	81	2	80	Cellulase N-terminal ig-like domain.
pfam00759	Glyco_hydro_9	2.91e-12	103	370	3	258	Glycosyl hydrolase family 9.
COG1331	YyaL	0.002	289	354	427	501	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS16657.1	0.0	1	594	1	594
AYB34129.1	1.18e-193	2	585	29	613
ABF39431.1	4.84e-190	1	589	24	611
QEY34812.1	1.46e-187	1	585	1	583
QEC64225.1	2.90e-184	1	585	21	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DGQ_A	3.79e-151	1	585	1	570	Crystalstructure of GH9 exo-beta-D-glucosaminidase PBPRA0520 [Photobacterium profundum],5DGQ_B Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520 [Photobacterium profundum],5DGR_A Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520, glucosamine complex [Photobacterium profundum],5DGR_B Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520, glucosamine complex [Photobacterium profundum]
3H7L_A	5.44e-148	3	583	4	561	ChainA, ENDOGLUCANASE [Vibrio parahaemolyticus],3H7L_B Chain B, ENDOGLUCANASE [Vibrio parahaemolyticus],3H7L_C Chain C, ENDOGLUCANASE [Vibrio parahaemolyticus]
6GDT_A	4.91e-139	1	583	1	559	Crystalstructure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_B Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_C Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_D Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_E Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961]
3X17_A	1.09e-08	2	540	17	510	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_02523.