CAZyme Information: MGYG000001538_00771

Basic Information

• Species: Collinsella ihuae
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella ihuae
• CAZyme ID: MGYG000001538_00771
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		39714.74	5.6163

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001538	2836446	Isolate	not provided	not provided

• Gene Location: Start: 571556; End: 572620 Strand: -

Full Sequence      

MAERIRGVNLSGWFIPEPWVTPSLYAATGASNDVELQQAMGSATYSDRLRQHYETFISEF
DFNRMSAIGFNAVRLPVPWYVFGSQSDALAHIPAVDYVDRAMEWAEKYDMTVLLDLATVP
GGQGDSNESATTPETTADWHSTSNGRHVALNVLGKLAERYGTSPALLGIELLDSPIMSVR
RGLFNVTQGIPSHYLRNYYRDAYELVRAHMPEDKIVVFSDSGHPEMWKRFMSGAKYQNVY
MDLHLYHYRDDTAVDITSPKGISQAVARNRRLIKEARSCGFPVIVGEWSAAAVMSSSTVT
PEGRDAYERVFISSELASFGEAAGWFFQTWKTEKRIPAWDARVALSPLERAMID

Enzyme Prediction     

No EC number prediction in MGYG000001538_00771.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	308	1.4e-60	0.8708609271523179

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.07e-22	5	334	18	366	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.47e-05	69	307	37	252	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68982.1	7.93e-197	3	354	2	353
QIA34389.1	1.60e-196	3	354	2	353
ATP54675.1	1.86e-195	3	354	2	353
AEB06471.1	2.49e-184	1	353	1	353
QWT17456.1	4.31e-172	4	354	28	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	2.10e-43	4	288	2	296	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	5.74e-43	4	288	2	296	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	6.36e-31	5	339	9	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	4.42e-30	5	339	9	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3O6A_A	4.76e-30	5	339	14	372	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8N151	6.25e-39	2	340	28	382	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	6.25e-39	2	340	28	382	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
A2RAR6	1.48e-38	2	346	39	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q5B5X8	8.82e-38	1	346	25	386	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q0CR35	7.75e-37	2	342	37	394	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999011	0.000913	0.000062	0.000005	0.000002	0.000018

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001538_00771.