CAZyme Information: MGYG000001537_03562

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_03562
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643	MGYG000001537_13|CGC10	69668.3	5.8118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 913126; End: 915057 Strand: +

Full Sequence      

MRTPSPHSGPVAPRATERLAQRPLPSGSVRLDPAGHLGAWQRLNATATLPHCVEMLERSG
ALDNLRRVAGRFEGPYVGYNFADSDVYKVLEAIGWEIGRTGTTEWDGFLADTLELLCAAQ
DSDGYLDSWVQGTRPGERFADLRWSHELYCAGHLVQAAIALHRGAGREDFLALARRTADL
VVRRFGPDGQIGVCGHPEIETALVELYRTTGHGPYLDLARSMVDARGQGLLGPDRLGPHY
FQDHAPVRESLEATGHAVRQLYLNAGVTDVYTEQGDPSLLRAMREQWESAHEQKMHVTGA
LGSRHFDESFGDPYELPPDRAYAETCAAIADVMWGHRMLLVEGSSRHADAIERALLNAVE
AAVGRDGRTFFYSNPLHLRAGHREEENAPSRRTPWYSCACCPPNIARLAASLHTYVGTCD
DDTLYVHLLTAAEIDLPAHLGEGTLRVTTDYPASGSVHIEVDGRLRDGAAIALRVPGWAT
QWRLAVDAASVEAPDVRDGYAVTRPGAAGHLSVELELAMPARLVAAHPRVDAVRGTRAVL
RGPVVYCVEQADHRGTGSIEDLALLPDAEISVLAAEPGDLPTLRLTALARPASQGLYASA
SADEPTAPGPASPEGVRVDVTAIPYARWGNRAPGPMRVWLPLA

Enzyme Prediction     

No EC number prediction in MGYG000001537_03562.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	36	547	1.3e-177	0.9866412213740458

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	4.83e-148	22	640	10	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	3.85e-126	28	547	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACQ78323.1	2.54e-228	8	641	14	637
QOR70894.1	7.06e-222	4	642	28	658
ACZ20251.1	2.30e-216	4	641	5	640
AQX15989.1	1.53e-214	11	641	6	611
VEP40492.1	1.53e-214	11	641	6	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.22e-116	57	640	50	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.74e-112	57	640	50	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	8.92e-98	58	639	50	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.17e-97	58	639	50	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	3.23e-97	58	639	50	655	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.89e-97	58	639	50	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001537_03562.