CAZyme Information: MGYG000001537_02681

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_02681
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	MGYG000001537_12|CGC16	58787.56	9.3385

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 1022032; End: 1023603 Strand: +

Full Sequence      

MFIFLLQVRHMLDDNSELYLFAVFSGLVWLLWLLKVVLSRRYRPFTAEHLARTSVIVPVV
DEPLDLFREVLGRVTEQSPDEVIVVINGAPNPGLVAVCEEFAPLVQWVHTPIPGKRNAVK
IGTEMSRHEITVLLDSDTIWTEGTLPELVKPFADSSIGGVTTRQRILEPTRSWITRWADW
LENSRSLYSMPAQSVLGQVGCLPGRTIAFRREILIRAMDDFMNQKFMGVFLEVSDDRTLT
NLTLKQGYRTVYQHTSLVYTDAPLEIKKLFKQQLRWARGSQYNTLRMLPWMLGHAPVLAV
FFLADILLPFLLIGTLLGWAYRAISGTGVNLYQAILETYGARSGWLWVVALMLVSTVLSM
AVRQIRHLQEVPSDFFRLPMFIIVSTFFLMPVRLLGFLRMAHASGWGTRAGAYAGGDPAP
APDAPRPDRPEPLVPDQRPAHDDDLMAELAQLELSGADGMHSPTRVAVRERRVTRTTVQH
PPAAAPVQVLPGADRARRRRNPKAAIPYAIAAIVLSLEALLYV

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	53	279	3.2e-25	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06434	GT2_HAS	3.80e-84	53	283	2	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
COG1215	BcsA	9.19e-33	52	402	55	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.43e-23	55	218	1	170	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	7.36e-22	52	279	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04190	Chitin_synth_C	4.43e-15	125	283	71	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN85299.1	7.94e-275	1	523	1	550
QVI67497.1	1.50e-257	1	523	1	508
QHT57310.1	1.92e-256	1	523	1	501
QGQ18167.1	6.35e-255	1	523	1	501
QVI66221.1	1.82e-252	1	522	1	492

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C0H0	1.58e-28	2	409	13	412	Hyaluronan synthase OS=Streptococcus pyogenes OX=1314 GN=hasA PE=3 SV=1
Q8NKX1	1.58e-28	2	409	13	412	Hyaluronan synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=hasA PE=3 SV=1
Q5X9A9	2.15e-28	2	409	13	412	Hyaluronan synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=hasA PE=3 SV=1
P0C0H1	2.15e-28	2	409	13	412	Hyaluronan synthase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=hasA PE=3 SV=1
P0DB60	7.34e-28	34	409	46	412	Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=hasA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000025	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	39
292	314
319	336
343	365
375	397
505	522