CAZyme Information: MGYG000001537_02608

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_02608
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	MGYG000001537_12|CGC14	46646.91	4.4813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 945550; End: 946797 Strand: -

Full Sequence      

MQTTDASTTGRWFEDGALHLGVGIEDTFIPQERVGQRKLDEYELTQHYHLWREDLDLAAA
SGATLIRWGIPWYLVEKDEGVYDFGWVDQVAARMQELGLRCVVDLMHYGTPLWLENGFLN
PDYPTKVAAYARAVAERYRGVFTDYTPLNEPLVNAIWCGRDRRWPPYLEGHSGFVRVLLP
LAKGIVLAHRAILEVDPDATIVHVDAGFLWAGEHFPGLSHAELDEWRFLAMDLITGRVGA
VHPLREYLLSNSATTEDLAWFQSDPVLPHVLGVNYYPAFTTMRFDPATDQEIPVEAGAAG
LVDLVGAYAKRYGLPVAVTETARATPDDDEKVLWVEELFRAVAELRAAGVPLVAAFWFPM
LDLVDWSYRDGVGPADDYMMRFGLVDLVRGPDNVLERRPNPAYAVFQDQVRAALA

Enzyme Prediction     

No EC number prediction in MGYG000001537_02608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	36	410	1.4e-41	0.8834498834498834

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	3.27e-19	10	408	21	448	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.75e-11	10	399	22	437	Glycosyl hydrolase family 1.
pfam02449	Glyco_hydro_42	4.21e-09	51	140	12	125	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	3.87e-05	51	169	32	180	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN85320.1	1.20e-194	8	413	2	406
QPP06597.1	1.46e-170	11	415	3	405
SDG46662.1	2.21e-170	11	407	3	396
QOR69378.1	4.89e-165	11	413	3	403
QJU53223.1	6.49e-164	12	413	6	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VFF_A	2.36e-17	32	412	33	405	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
4HZ6_A	5.06e-13	3	385	15	415	crystalstructure of BglB [uncultured bacterium],4HZ7_A Crystal structure of BglB with glucose [uncultured bacterium],4HZ8_A Crystal structure of BglB with natural substrate [uncultured bacterium]
3CMJ_A	5.37e-13	3	385	36	436	ChainA, Beta-glucosidase [uncultured bacterium]
4PTV_A	2.17e-12	47	385	58	421	Halothermothrixorenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTV_B Halothermothrix orenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTW_A Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTW_B Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTX_A Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168],4PTX_B Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168]
3TA9_A	2.21e-12	47	385	64	427	beta-GlucosidaseA from the halothermophile H. orenii [Halothermothrix orenii H 168],3TA9_B beta-Glucosidase A from the halothermophile H. orenii [Halothermothrix orenii H 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P12614	2.74e-09	47	385	62	424	Beta-glucosidase OS=Agrobacterium sp. (strain ATCC 21400) OX=74562 GN=abg PE=3 SV=1
Q46130	1.97e-07	48	410	64	464	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000010	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001537_02608.