CAZyme Information: MGYG000001537_01972

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_01972
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		65676.65	6.6616

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 290332; End: 292134 Strand: +

Full Sequence      

MTRVPRTPEDDAPRQDGSAPLGPAGVPTAVEVDAAHPSAIDEPPGHDAGPPPWPPTDDCP
RDEPPADEEPPLPTVERLRRRLLGERTLLLDATPRARLTGWLWALAVTALAAVLRFVRLG
TPHSLVFDETYYVKDAFSLLTQGYEAQWGEEPNPSFEAGDTSMLGVDPSYVVHPPVGKWL
IGWGIELGGGAGSSAAWRLAAAIVGTLSVLLMVRIARRLFASNALGVTAGLLLAVDGAAI
VGSRISLLDGFVMFFALAAFGALILDREQARRRLADRTAVILDAGGTLGWGPRLGVRWWR
LAAAVLLGLCIGTKWSGLYFLAVFGLMSVAWDATARRAAGVRNWPLATFVRDAVPAGIGM
VGIAAVTYVASWASWFRTPQAYLRQWAVENPEQGVQWLPDALRSLWKYHQDMWGFHRGLT
SEHTYSAHPLGWIVQWRPTSYWYPSEVSSLSGDAAREACGADACAQAITSLGNPLLWWAG
AAAIIVALVWLVWQRDWRAGAVLSGIAAGWLPWFVYAERTIFTFYSVAFVPWVVLTLVYV
LGLVVGPPDGDRRARRQAIGWAAAFVALIVAVSAFFYPIWTAWVIPYDFWHMHMWLTSWI

Enzyme Prediction     

No EC number prediction in MGYG000001537_01972.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	107	376	2e-73	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	2.22e-28	115	600	38	694	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	1.22e-13	403	596	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	7.41e-11	115	326	11	194	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	4.95e-09	169	344	60	208	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	3.19e-06	172	265	1	91	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE47197.1	3.19e-288	68	600	69	602
VEH35556.1	3.19e-288	68	600	69	602
QVI66570.1	1.10e-278	71	600	57	590
QHT58147.1	2.08e-276	80	600	2	523
QWC16849.1	1.46e-272	73	600	89	622

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	1.02e-95	68	599	17	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.02e-95	68	599	17	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	4.68e-91	91	599	28	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	7.46e-66	97	599	32	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998859	0.001176	0.000006	0.000002	0.000001	0.000002

TMHMM  Annotations     

start	end
100	119
195	212
219	241
245	264
301	323
354	376
471	493
497	516
521	543
558	580