CAZyme Information: MGYG000001535_02073

Basic Information

• Species: Paenibacillus_A phocaensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A phocaensis
• CAZyme ID: MGYG000001535_02073
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207	MGYG000001535_17|CGC4	22707.82	4.3059

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001535	5515101	Isolate	not provided	not provided

• Gene Location: Start: 131890; End: 132513 Strand: -

Full Sequence      

MLIIGDSITCGFGNEAQIPCDCDASRENIALAYSSLTGQLLNAETLIVGASGTGCYQNFG
GAKEGRMSDYFMETLCPYLDQEAMDPFDPEVIVINLGTNDWSAPLEPSDYMEQYRKLVGF
IRGRYPSVPLFCAIGPMTLGPSPYLKALVERLSEEGDKNIHFVEFPLIQRPEDGMGGCGH
PSVKKHRQMAEQLAGTIGQICSWPQQQ

Enzyme Prediction     

No EC number prediction in MGYG000001535_02073.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	2	197	7.1e-52	0.9856459330143541

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	1.61e-44	1	197	2	168	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam13472	Lipase_GDSL_2	2.27e-14	3	184	1	172	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	9.86e-13	2	194	2	185	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01836	FeeA_FeeB_like	6.26e-10	1	197	5	189	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd01833	XynB_like	1.55e-07	89	197	41	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX67072.1	1.45e-133	1	202	125	326
QOT10772.1	4.15e-133	1	202	125	326
AYB47732.1	3.94e-131	1	204	125	328
BCJ98009.1	1.08e-114	1	202	125	326
QNU68524.1	6.45e-38	4	203	234	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	2.26e-32	4	203	128	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	6.19e-32	4	203	128	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
4XVH_A	4.79e-16	3	203	114	329	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]
2W9X_A	8.80e-07	4	199	148	355	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	2.54e-30	4	203	609	814	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PDE5	4.78e-06	4	199	148	355	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999979	0.000081	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001535_02073.