CAZyme Information: MGYG000001531_01389

Basic Information

• Species: Enterocloster sp001517625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp001517625
• CAZyme ID: MGYG000001531_01389
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000001531_7|CGC2	42031	4.4916

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001531	3412690	Isolate	not provided	not provided

• Gene Location: Start: 158415; End: 159509 Strand: +

Full Sequence      

MCDNVNIAYEELLNRVSSCMLTMKNNGIEERFPISLIDINCWEWPQGVGIYGLYKYYETS
GRQDILDFLIHWYDERMEEGILEKNVNTTAPMLTLTYIYEITRKEEYLDLIREWTAWIMD
GSLIRTGDGCFQHMITGDPNQSEILIDTLFMTVLFLARAGVILGRKDCVDEANYQFLQHI
KYLLNKKEGLFYHGFNFDRNNNYGEIMWGRGNSWYTVAIMDYLEMVEIDEGLKRHFLTVY
YDQVNALKKYADRDCGLWHTIINDNSSYIEISASAGFLCGILHGIRTGHLDINEYGDMVD
KALAHLPEYIKEDGTVMNVSYGTPIGENADFYKEIICCPMTYGQAMTIMALQEAMVYTGK
GKAV

Enzyme Prediction     

No EC number prediction in MGYG000001531_01389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	354	1.7e-91	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.47e-89	42	356	34	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	7.58e-78	19	353	6	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94867.1	1.20e-188	12	355	10	354
SET87383.1	2.68e-169	10	355	8	354
AGX06452.1	2.84e-130	16	360	15	357
APO45381.1	3.39e-130	10	355	8	350
QZN73749.1	4.81e-130	10	355	8	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	3.64e-81	42	353	65	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.75e-81	42	353	66	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.09e-71	42	353	47	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	5.07e-18	42	290	23	283	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	8.35e-12	27	332	67	387	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.27e-46	42	335	29	315	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000015	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001531_01389.