CAZyme Information: MGYG000001529_02594

Basic Information

• Species: Gabonibacter massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Gabonibacter; Gabonibacter massiliensis
• CAZyme ID: MGYG000001529_02594
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545	MGYG000001529_7|CGC10	63714.15	9.8061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001529	3396579	Isolate	not provided	not provided

• Gene Location: Start: 1995126; End: 1996763 Strand: +

Full Sequence      

MQKRDWIHILFILVVCWFAFFVNNDAIFVDIMESRNLVTAHEMETYDNWLVPTMNGELRL
EKPPLPTWIAAGIDMISPDNIALQRGAAGLMATIMVFFLYFFASALTQNKLFGLLSALVL
ATSFNVIMQGRVATWDIYCHSFMLGAIFFFYRGMAAMRTRWWDFCVAGILLGLSFLGKGP
VSFYALLLPFLMSYFFIYRPKFGHKLWPVLLMVLIFILISFWWPLYLYVFHKDMALFVMA
KESTAWIERNVRPWYYYWKFFTESGIWSLFLLTGLCWPWLKHKITLKKEYRLAIVWTLLS
LVLLSCFPEKKTRYLLPLLIPSAMVVAHYVLYIFIAVKEKSLTKGDKIVFRINAFLPAII
ALGMPVALYVLFFQTRQIGWVYYIVVSFLFWLVSYSIFVGGIRLKPLKVFTGMVILLILV
ETLLMNSVATMFNNEEIKSIRAVREIESINKLPFYYPQEEELRMELVYEAGRRILPWDTG
KDTAILDSLPIVLVSGRPAEDVLPESVRERVKLRLVDVYDNNARKKNTKWHSPKFVRYVT
VIEKR

Enzyme Prediction     

No EC number prediction in MGYG000001529_02594.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	440	1.9e-59	0.812962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.65e-28	1	426	2	428	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.05e-13	42	405	42	404	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.93e-13	62	224	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.89e-06	42	230	41	237	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	0.001	90	231	118	269	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBB93296.1	7.33e-17	9	329	9	328
AEI13959.1	7.24e-16	33	363	34	356
ADR19199.1	1.66e-15	3	332	5	331
QTL97755.1	1.23e-14	33	327	47	345
AAC07235.1	4.52e-14	19	329	24	320

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	9.04e-15	19	329	24	320	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q3KCC9	2.13e-11	33	330	50	350	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
Q4ZSZ0	7.28e-09	33	369	34	364	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
Q4K884	1.00e-08	33	368	65	394	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
Q4KC80	1.27e-08	33	328	32	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.866068	0.127729	0.004474	0.000287	0.000281	0.001164

TMHMM  Annotations     

start	end
7	29
82	104
111	128
132	154
166	188
208	230
258	280
290	307
314	336
351	373
380	402
412	434