CAZyme Information: MGYG000001529_02127

Basic Information

• Species: Gabonibacter massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Gabonibacter; Gabonibacter massiliensis
• CAZyme ID: MGYG000001529_02127
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268		31178.48	5.2443

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001529	3396579	Isolate	not provided	not provided

• Gene Location: Start: 1452481; End: 1453287 Strand: +

Full Sequence      

MAKKRVLFISQEIVPYLPESEMANIGRYLPQGIQDKGKEIRTFMPRYGCINERRNQLHEV
IRLSGMNLIINDTDHPLIIKVASIQAARMQVYFIDNDDYFQRKHVITDSEGNFFDDNDER
AIFFARGVFETVRKLRWAPDLIYCQGWLTSLVPLYLKKEYQDDPVFSKAKVVFSTYNDKF
EGSLNHKFAEKAITEGVFPKDLTLVKEPTHTNINKLAFQYSDGIIFNQPDIEDELKRFAE
ASGKPILEYPGEESYVDQYSDFFDKIIG

Enzyme Prediction     

No EC number prediction in MGYG000001529_02127.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	226	3.5e-44	0.4470338983050847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	2.05e-52	6	225	1	214	Starch synthase catalytic domain.
PRK14098	PRK14098	3.01e-44	1	198	1	201	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.11e-28	5	224	1	212	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	4.05e-23	5	182	2	160	glycogen synthase GlgA.
COG0297	GlgA	2.43e-18	5	182	2	171	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO49825.1	3.06e-172	1	267	1	267
AZS31272.1	4.35e-172	1	267	1	267
SNV43872.1	4.95e-154	1	267	1	267
ADY34094.1	4.95e-154	1	267	1	267
QIA09804.1	9.71e-134	1	266	1	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNG_A	5.65e-07	3	188	39	231	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]
6GNF_A	2.31e-06	6	182	24	207	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3B6C3	3.33e-41	5	197	7	200	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B3EGV0	2.42e-40	5	197	7	200	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
A1BIY8	2.44e-39	5	197	7	200	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
B3QR00	9.00e-39	5	242	7	242	Glycogen synthase OS=Chlorobaculum parvum (strain DSM 263 / NCIMB 8327) OX=517417 GN=glgA PE=3 SV=1
B4SC83	6.58e-38	5	197	7	200	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999735	0.000265	0.000023	0.000001	0.000001	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001529_02127.