CAZyme Information: MGYG000001526_02980

Basic Information

• Species: Paenibacillus_A senegalimassiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A senegalimassiliensis
• CAZyme ID: MGYG000001526_02980
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000001526_15|CGC4	40816.8	4.4286

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001526	5059338	Isolate	not provided	not provided

• Gene Location: Start: 129146; End: 130231 Strand: +

Full Sequence      

MSETSARRPSAKYTGVWSERAAQMHNDLFTCYTDEQTGILAQWYPQAASKEGENFYYWWQ
AHVLDVLVDAWERSGEAELPQRIARFCHSLESYNGNTFKHNYYDDMEWTALALLRAYDTT
GDSWYKEKTLDLWEDIKTAWNEHFGGGMAWKKDQLDYKNTPANATAAILAARLYRRFGDS
ENLAWSKKIYAWNLTHLVDPITGFVWDGINRLGDGQIDKEWTFTYCQGVFIGAGVELYQC
TGDAAYLEQAQRTSAACFDQVCEPDSDLLPDEGIDDTGLFKGILIRYLVELLRVDPECPR
VRGVILANAERLWNAGVLQPSGLCGPSWKEPPTLPVQLSVQLSGLMLLEAAAILTGELTD
A

Enzyme Prediction     

No EC number prediction in MGYG000001526_02980.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	39	339	2.7e-89	0.8491620111731844

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	2.08e-61	17	353	3	369	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	1.02e-31	17	328	2	330	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY75148.1	4.17e-205	16	357	16	357
AIQ24454.1	2.28e-165	17	357	13	353
ACX62679.1	2.96e-164	17	355	365	703
AYB46855.1	4.28e-163	17	355	396	734
QOT09052.1	7.92e-162	17	355	366	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	8.57e-81	17	354	54	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.78e-79	17	354	55	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.20e-78	17	354	55	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	3.57e-72	17	352	3	338	ChainA, Lin0763 protein [Listeria innocua]
4MU9_A	1.66e-30	102	328	116	338	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001526_02980.