CAZyme Information: MGYG000001524_01634

Basic Information

• Species: RUG013 sp001486445
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; RUG013; RUG013 sp001486445
• CAZyme ID: MGYG000001524_01634
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		54323.14	7.5827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001524	2090171	Isolate	not provided	not provided

• Gene Location: Start: 1232952; End: 1234430 Strand: +

Full Sequence      

MDTTSPAQTDTRTPESAPRLGPEALGAEDLRIFGEIEAWRKGDSDAQDQRMRATYHVDKE
LAFRDSYQPPHPTILILHASVGSGHRSAAIAIAQDLCDLRDRQLPAFPDGSPLDPATRVV
VADILAWGDHVFDGNKTATSFTGSTRPLYDLTWRYTFTGRALWGQGTFLNYVMWRKFTRY
IGHIKPLAVIATHIMGANMAAGARTICKQHYPLVCVPTDYETEGLWPHKAADVFCLGNES
MAETLRARHIAENRIAITGIPTRIDFRRSYDTAQVRERFGLPADKKIVLALAGATLPQPY
VIFRQTLESVIPAFAGHPDLHLVMVCGKDADYAAHVRQTCAEHGLDNVTVLDYVNGMAAL
MAASDVIVTKSGGLTVTECLVSRTPMILVGRAYGQEKVNVNMLTNAGAAIHVTTARELVS
QIDLIDQHPERLSSMVVNANLLRRPNAAHDIARCTLALTKLPADDVRHTVVTKKLAWTLF
NFYWGDKPAHIR

Enzyme Prediction     

No EC number prediction in MGYG000001524_01634.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	309	447	5e-27	0.8980891719745223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	9.98e-51	74	453	1	357	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	3.96e-35	168	460	74	356	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13609	PRK13609	5.97e-34	72	467	5	377	diacylglycerol glucosyltransferase; Provisional
cd03785	GT28_MurG	2.00e-27	247	452	146	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	1.78e-23	246	460	147	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACU94689.1	1.10e-204	71	492	133	561
ACV55211.1	4.40e-168	14	492	37	516
QOS69492.1	7.95e-167	72	492	55	478
BAK44346.1	1.35e-164	70	492	28	465
QTU84801.1	1.78e-161	72	492	39	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	1.09e-09	74	462	8	391	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]
3S2U_A	4.67e-06	350	460	239	356	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54166	2.69e-21	212	451	129	361	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
A8FED1	4.96e-21	212	451	129	361	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
Q65IA4	9.05e-21	212	451	129	361	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ugtP PE=3 SV=1
Q49WE6	1.95e-19	212	458	129	368	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=ugtP PE=3 SV=1
A9VSQ8	3.43e-19	212	457	129	367	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus mycoides (strain KBAB4) OX=315730 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001524_01634.