CAZyme Information: MGYG000001514_05032

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_05032
• CAZy Family: GH11
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
211	MGYG000001514_12|CGC65	23475.93	9.6911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 3852362; End: 3852997 Strand: -

Full Sequence      

MFKFKKKILTAVLVASMSFSMFAAISSAATDYWQNWTDGGGTVNAVNGSGGNYSVTWYNT
GNFVVGKGWNTGSPNRVINYNAGIWEPSGNGYLTLYGWTRNALIEYYVVDSWGTYRPTGT
YKGTVTSDGGTYDVYTTMRYNAPSIDGTQTFQQYWSVRQSKRPTGNNVSITFSNHVNAWR
NFGMHLGSNWSYQVLATEGYQSSGRSNVTVW

Enzyme Prediction     

EC	3.2.1.8	3.1.1.72	3.1.1.6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	31	209	1.1e-70	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00457	Glyco_hydro_11	9.68e-88	31	207	3	175	Glycosyl hydrolases family 11.
PRK06215	PRK06215	0.007	1	135	8	167	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK48681.1	3.45e-152	1	211	1	211
AZS13819.1	4.47e-139	1	211	1	211
AKJ70928.1	3.54e-138	3	211	2	210
AAB72117.1	1.44e-137	3	211	2	210
ALP35915.1	1.49e-137	1	211	1	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KV0_A	6.80e-125	29	211	4	186	ChainA, Endo-1,4-beta-xylanase [Paenibacillus xylanivorans],7KV0_B Chain B, Endo-1,4-beta-xylanase [Paenibacillus xylanivorans]
1XXN_A	1.42e-119	28	211	1	185	Crystalstructure of a mesophilic xylanase A from Bacillus subtilis 1A1 [Bacillus subtilis],2DCY_A Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_B Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_C Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_D Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_E Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis]
1BVV_A	4.06e-119	28	211	1	185	ChainA, ENDO-1,4-BETA-XYLANASE [Niallia circulans],1XNB_A Chain A, XYLANASE [Niallia circulans],2B42_B Crystal structure of the Triticum xylanse inhibitor-I in complex with bacillus subtilis xylanase [Bacillus subtilis],3HD8_B Crystal structure of the Triticum aestivum xylanase inhibitor-IIA in complex with bacillus subtilis xylanase [Bacillus subtilis],3HD8_D Crystal structure of the Triticum aestivum xylanase inhibitor-IIA in complex with bacillus subtilis xylanase [Bacillus subtilis]
2QZ3_A	1.16e-118	28	211	1	185	ChainA, Endo-1,4-beta-xylanase A [Bacillus subtilis],2QZ3_B Chain B, Endo-1,4-beta-xylanase A [Bacillus subtilis],2Z79_A Chain A, Endo-1,4-beta-xylanase A [Bacillus subtilis],2Z79_B Chain B, Endo-1,4-beta-xylanase A [Bacillus subtilis]
2BVV_A	1.65e-118	28	211	1	185	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE) [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45705	2.88e-138	3	211	2	210	Endo-1,4-beta-xylanase A OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=3 SV=2
V9TXH2	9.47e-128	1	211	1	210	Endo-1,4-beta-xylanase Xyn11E OS=Paenibacillus barcinonensis OX=198119 GN=xyn11E PE=1 SV=1
P18429	7.10e-126	1	211	1	213	Endo-1,4-beta-xylanase A OS=Bacillus subtilis (strain 168) OX=224308 GN=xynA PE=1 SV=1
P09850	2.03e-125	1	211	1	213	Endo-1,4-beta-xylanase OS=Niallia circulans OX=1397 GN=xlnA PE=1 SV=1
D7EZJ3	1.26e-78	32	210	67	239	Endo-1,4-beta-xylanase B OS=Streptomyces sp. OX=1931 GN=xynBS9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000209	0.999155	0.000166	0.000176	0.000151	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001514_05032.