CAZyme Information: MGYG000001510_01622

Basic Information

• Species: Numidum massiliense
• Lineage: Bacteria; Firmicutes; Bacilli; Thermoactinomycetales; Novibacillaceae; Numidum; Numidum massiliense
• CAZyme ID: MGYG000001510_01622
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		31104.78	10.054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001510	3755739	Isolate	not provided	not provided

• Gene Location: Start: 1580765; End: 1581595 Strand: +

Full Sequence      

MNAMTNEQTRRRTIERTKEHTKKRTKNRQRRPRRLLAIAIAAVLVALVAMPALGVIGNVL
IDDQKLLELERPVFQQQSDSQAFVHYSDMPDYLWQAFIAIEDHRFERHNGVDLQALARAL
VADVAAGSKAEGGSTITMQLARNVFLSHDKSFSRKLKEIAIAIHLEQRYTKQQLLEMYLN
RIYFGHGQYGIEAAANMYFGKTVRAGSADRATITLNEAALLAALPKAPEIYSPRNNFAKA
IERRNLVLQRMVDVGFITNAEKEAAMSEDVTVLPAE

Enzyme Prediction     

No EC number prediction in MGYG000001510_01622.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	77	252	1.9e-66	0.9491525423728814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	7.16e-80	83	274	4	188	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	6.51e-72	71	252	3	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	1.49e-70	83	272	69	251	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	9.62e-70	83	275	78	264	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	3.22e-51	87	268	72	246	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS55619.1	9.00e-79	29	273	5	249
QKG84271.1	7.15e-77	57	268	51	263
QRG70019.1	3.46e-72	33	275	33	262
AQS55839.1	1.91e-68	35	276	40	289
QAV16081.1	2.53e-68	33	272	34	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	2.34e-50	83	268	22	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	9.32e-50	83	268	22	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.44e-43	84	270	42	221	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	1.47e-41	79	268	55	243	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.48e-41	79	268	19	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	3.92e-52	38	272	15	249	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q9KNU5	4.25e-46	88	270	73	248	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
O66874	4.65e-46	83	272	65	247	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P02918	8.38e-43	65	270	40	248	Penicillin-binding protein 1A OS=Escherichia coli (strain K12) OX=83333 GN=mrcA PE=1 SV=1
Q07806	1.46e-42	84	270	69	248	Penicillin-binding protein 1A OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mrcA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999278	0.000726	0.000001	0.000001	0.000000	0.000007

TMHMM  Annotations     

start	end
35	57