CAZyme Information: MGYG000001508_02762

Basic Information

• Species: Thalassobacillus devorans
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Halobacillaceae; Thalassobacillus; Thalassobacillus devorans
• CAZyme ID: MGYG000001508_02762
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	MGYG000001508_5|CGC23	66704.92	4.4996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001508	4066265	Isolate	not provided	not provided

• Gene Location: Start: 1930579; End: 1932342 Strand: -

Full Sequence      

MDLTVTPMSHFGSYMALTYQENSEPEKEGIYVNAVRGKSKQHQNALKIIPTKNGEPVNYS
YEADEFQITIHVDGGILDICFEDELRIFVRGTGENLGLILDTQPIYNFEYNYLLGKSGDE
YCIVNSYKNLTKYLIFAPQGSLSMKQNVFMDTTGSTNKADNLSSIHIDAEEESGEFLCVI
EDIPTHGSIPADREYSFDQALAKSKAHFEDFLAKQPVVPEGYQQTLREAAYLNWTCIKNE
EGLLKRKAMFMSNSNFPGVWSWDNAFNGLALAGVDDQLAWDQIQCLFDHQDEKGQIPGSI
SDSTIRWNFSKPPVQGLFVLKMMDRMALTEEQLEQMYQQIEAHVNFYFRFKDSNQDGIPE
YHHGNDSGQDNSTVFRNADIIDSPDLLAFLIKSMDMLAVAAKKLQRPKDEQYWKEAAQKY
TDLFCDYFIVDDLPVARYTRTGEKIDSEGYLPLVSLILADKLPESVKKKMIETLSSGRYL
TEWGIASEAIDSPLYEEDAYWRGPIWAPTTLLFIDAFEACGEYDLADEVAEKFLKLCKHG
GFAENFHAETGEGLRDLAHTWTSSVFIHLAARQQEKNNNNRKQAVTV

Enzyme Prediction     

No EC number prediction in MGYG000001508_02762.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	198	570	5e-42	0.47719298245614034

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	1.00e-24	115	567	155	600	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	3.74e-09	143	552	227	762	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	2.75e-08	252	565	85	488	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWC23728.1	0.0	1	572	1	572
QTC41649.1	0.0	1	572	1	572
AXU91496.1	1.99e-234	1	572	1	566
QPL01237.1	1.99e-234	1	572	1	566
AXU69363.1	1.99e-234	1	572	1	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	1.09e-08	256	565	28	414	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
2Z07_A	4.46e-08	256	565	28	414	Crystalstructure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]
3W7S_A	5.98e-07	201	551	255	734	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.37e-06	201	551	255	734	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.11e-06	201	551	255	734	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D8QTR2	3.84e-12	256	565	94	480	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.84e-12	256	565	94	480	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P42592	3.31e-06	201	551	278	757	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001508_02762.