CAZyme Information: MGYG000001506_01453

Basic Information

• Species: Neofamilia massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Neofamilia; Neofamilia massiliensis
• CAZyme ID: MGYG000001506_01453
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263	MGYG000001506_3|CGC3	29961.7	8.8412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001506	1920334	Isolate	not provided	not provided

• Gene Location: Start: 582434; End: 583225 Strand: -

Full Sequence      

MVEVVNNEEKLMANKKIFVGLPCYNEEKNIGKLLDSWLDLADDLLQRGYELVLRPVDDKS
SDKTKDILEAYANKYSNIKPIYHKENKNLGGGLNSIINTFLANCQRGDLLAVMDGDYTHL
PIFSLSMIDKLAYSYDIVIASRYRKGSEIHGLSKFREMMSIGARIYYSLVLGIKGVRDYT
CGYRIYTYEILEEGKNKYKENLVQNTSFACMMELLYKLYKSGAKIAEVPFVLKYDNKEGE
SKMNVGKTSKDSIVSAIKLRLGK

Enzyme Prediction     

No EC number prediction in MGYG000001506_01453.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	20	160	4.6e-20	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06442	DPM1_like	1.98e-42	21	244	3	210	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.
cd04179	DPM_DPG-synthase_like	9.20e-38	21	218	3	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd04188	DPG_synthase	8.31e-26	21	229	3	201	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
PLN02726	PLN02726	1.47e-24	21	246	15	227	dolichyl-phosphate beta-D-mannosyltransferase
pfam00535	Glycos_transf_2	3.63e-22	19	191	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ21572.1	6.49e-71	12	254	1	243
AEI33981.1	6.49e-71	12	254	1	243
AAK80475.1	6.49e-71	12	254	1	243
AWV79109.1	6.49e-71	12	254	1	243
QNU66960.1	3.32e-57	16	260	3	253

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2DZE8	3.26e-13	13	262	71	314	Dolichyl-phosphate beta-glucosyltransferase ALG5A OS=Trichomonas vaginalis OX=5722 GN=ALG5A PE=1 SV=1
A2DSR8	7.12e-12	21	262	79	314	Dolichyl-phosphate beta-glucosyltransferase ALG5E OS=Trichomonas vaginalis OX=5722 GN=ALG5E PE=1 SV=1
A0A0H3M5A8	6.12e-11	14	254	609	834	Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lnt PE=1 SV=1
O53493	6.12e-11	14	254	609	834	Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppm1 PE=1 SV=1
A2ELE6	1.57e-10	21	262	82	320	Dolichyl-phosphate beta-glucosyltransferase ALG5C OS=Trichomonas vaginalis OX=5722 GN=ALG5C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001506_01453.