CAZyme Information: MGYG000001506_01450

Basic Information

• Species: Neofamilia massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Neofamilia; Neofamilia massiliensis
• CAZyme ID: MGYG000001506_01450
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698	MGYG000001506_3|CGC3	76069.04	5.2351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001506	1920334	Isolate	not provided	not provided

• Gene Location: Start: 578365; End: 580461 Strand: +

Full Sequence      

MKRNRILGLLMALVLVVGLVLPGQKVFAADQKVITILHTNDVHGNVVENEKDGKLGYAKL
KTFADSKENAILVDAGDVLHGTTFATISKGQSIVDLMNLVGYKAMAPGNHDYNYGSDRLK
ELATKAEFPILSANVVDKDGKLFLKDRTIIDVDGVKVGIFGITTPETRTKSNPKNTEGLG
FTNYIEAARVQVAQLKEEGSDVVVALVHLGLDPASKERSDVLAKEVAGIDLIIDGHSHTD
LANGKLENGVLIAQTGDHTKNIGEVTLVVEDGKVSAKSAKLHPYEELKGLEANKEILGKI
EEVEKANKPYLDRVVGKTAVDLDGLRDHVRTGETNLGNLVTDAMLNLTKADVALTNGGGI
RESIAKGDVTMGQILQTFPFANYPVVIEVTGQTIKDALEYGVDSAPEVVGKFPHIAGMTF
KYDQNQKPGSRVFDVVVGKEALDLNKTYKLVTNDFMAGGGDGYEMFKGTKKLSEYPLLSE
VLADYIEKEKVVEPKVEGRVVAAAMPKTEEQVGFTDIKGHWGEEFINSVVEDKIFMGTSK
TTFEPNANITRAMIVTTLYRLEGMPEVKNPAEFSDVKTNMWYSDPIAWAAANDIVKGYED
KSYKPDQEVTREEMAAIISRYLAYKAVPVTSMLPEAFADQDKIATWALTDVQTVQLTKIM
SGKPGNLFDPQGKATRAELAKVMYQINLLVNAEVKKAA

Enzyme Prediction     

No EC number prediction in MGYG000001506_01450.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09419	PRK09419	1.23e-113	30	515	657	1158	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.
COG0737	UshA	2.19e-112	28	486	21	495	2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family [Nucleotide transport and metabolism, Defense mechanisms].
PRK09558	ushA	1.96e-99	34	488	35	533	bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed
cd07408	MPP_SA0022_N	2.77e-78	34	276	1	248	Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain. SA0022 is an uncharacterized Staphylococcus aureus UshA-like protein with two putative domains, an N-terminal metallophosphatase domain and a C-terminal nucleotidase domain. SA0022 also contains a putative C-terminal cell wall anchor domain. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.
cd00845	MPP_UshA_N_like	3.87e-69	34	272	1	241	Escherichia coli UshA-like family, N-terminal metallophosphatase domain. This family includes the bacterial enzyme UshA, and related enzymes including SoxB, CpdB, YhcR, and CD73. All members have a similar domain architecture which includes an N-terminal metallophosphatase domain and a C-terminal nucleotidase domain. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY79959.1	7.97e-172	2	509	4	517
QZY54554.1	7.31e-155	4	509	2	509
AGA59602.1	7.48e-150	1	500	1	502
AST94697.1	4.96e-143	19	506	16	504
QNM45137.1	4.96e-143	19	506	16	504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z1A_A	2.00e-68	1	514	1	542	Crystalstructure of 5'-nucleotidase precursor from Thermus thermophilus HB8 [Thermus thermophilus HB8]
5H7W_A	1.42e-58	34	504	5	526	Crystalstructure of 5'-nucleotidase from venom of Naja atra [Naja atra],5H7W_B Crystal structure of 5'-nucleotidase from venom of Naja atra [Naja atra]
7D0V_A	2.00e-58	34	504	5	526	ChainA, Snake venom 5'-nucleotidase [Naja atra],7D0V_B Chain B, Snake venom 5'-nucleotidase [Naja atra]
6VC9_A	6.86e-57	34	500	3	520	TB19complex [Homo sapiens],6VCA_A TB38 complex [Homo sapiens],6VCA_B TB38 complex [Homo sapiens],6VCA_C TB38 complex [Homo sapiens],6VCA_D TB38 complex [Homo sapiens]
4H2I_A	7.29e-57	34	500	4	521	Humanecto-5'-nucleotidase (CD73): crystal form III (closed) in complex with AMPCP [Homo sapiens],6TVX_A Human CD73 (ecto 5'-nucleotidase) in complex with PSB12676 (an AOPCP derivative, compound 9 in paper) in the closed state [Homo sapiens],6TW0_A Human CD73 (ecto 5'-nucleotidase) in complex with PSB12690 (an AOPCP derivative, compound 10 in publication) in the closed state [Homo sapiens],6TWA_A Human CD73 (ecto 5'-nucleotidase) in complex with PSB12646 (an AOPCP derivative, compound 20 in publication) in the closed state [Homo sapiens],6TWF_A Human CD73 (ecto 5'-nucleotidase) in complex with PSB12604 (an AOPCP derivative, compound 21 in publication) in the closed state [Homo sapiens],6YE1_A Chain A, 5'-nucleotidase [Homo sapiens],6YE1_B Chain B, 5'-nucleotidase [Homo sapiens],6YE2_A Chain A, 5'-nucleotidase [Homo sapiens],6YE2_B Chain B, 5'-nucleotidase [Homo sapiens],6Z9B_A Human Ecto-5'-nucleotidase (CD73) in complex with AOPCP derivative A830 (compound 16 in publication) in the closed form (crystal form III) [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34313	1.33e-74	34	515	669	1189	Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkN PE=1 SV=1
A9BJC1	4.61e-71	4	493	2	498	Mannosylglucosyl-3-phosphoglycerate phosphatase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) OX=403833 GN=mggB PE=1 SV=1
P29240	2.44e-62	34	515	32	565	5'-nucleotidase OS=Diplobatis ommata OX=1870830 PE=2 SV=1
B6EWW8	4.09e-61	28	522	38	578	Snake venom 5'-nucleotidase OS=Gloydius brevicaudus OX=259325 PE=2 SV=1
F8S0Z7	2.74e-59	28	522	38	578	Snake venom 5'-nucleotidase OS=Crotalus adamanteus OX=8729 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999095	0.000185	0.000162	0.000155	0.000142

TMHMM  Annotations     

start	end
7	29