CAZyme Information: MGYG000001504_00888

Basic Information

• Species: Mt11 sp001282665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Tepidimicrobiaceae; Mt11; Mt11 sp001282665
• CAZyme ID: MGYG000001504_00888
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218	MGYG000001504_14|CGC1	25622.97	9.1595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001504	3566389	Isolate	not provided	not provided

• Gene Location: Start: 47125; End: 47781 Strand: +

Full Sequence      

MRWRTNKFFKRILTFVIIAIILVTVGAIYLTVTYPLSYKKSIDIYSKKYNVDPYLIAAII
NVESNYDKKAISHKEARGLMQISPSTGYWAAELLKIEDFNLDLLFEPETNIMIGTWYLDN
LSKEFDNNLQLMLAAYNGGSGNVKKWLENMEYCEDGIYLKKIPFKETEQYVEKVLKNVKV
YKMLYKDEFEKPVTHEENSFIVVLHNLRKVIKNLVLYK

Enzyme Prediction     

No EC number prediction in MGYG000001504_00888.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	50	181	1.3e-31	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.78e-74	35	177	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.58e-55	34	184	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.17e-40	53	177	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.92e-36	8	185	108	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.70e-33	42	149	1	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SHD77963.1	2.11e-92	1	218	1	218
QQY80409.1	3.00e-87	1	218	1	217
QAT63457.1	2.34e-65	34	215	2	183
ARE87147.1	6.98e-62	5	186	13	196
QZY57461.1	9.52e-62	30	186	18	174

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	1.71e-19	31	185	413	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.71e-19	31	185	409	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.72e-19	31	185	419	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.73e-19	31	185	423	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.73e-19	31	185	429	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	5.30e-19	34	175	476	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	1.18e-18	33	177	1417	1540	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.18e-18	33	177	1417	1540	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P0AGC4	1.52e-17	34	188	476	632	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.52e-17	34	188	476	632	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.987299	0.003281	0.000270	0.000022	0.000010	0.009150

TMHMM  Annotations     

start	end
12	34