CAZyme Information: MGYG000001503_01962

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_01962
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558	MGYG000001503_2|CGC21	62898.23	6.669

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 1155451; End: 1157127 Strand: +

Full Sequence      

MIYKRGVISTFLLSAVFSIMFAGTSLADSVIWEPKVIGIPPSDAYIGLSLLESGEIRHYN
YGEQADEGTFYLSSKDKGLTWTKVNIPNNIPFADTRSPLSGEYLRLISSPGMGTYAIRTN
GGLNGGRELVKVSDSMGIMLKPPVFIRNGKRVVVAGHYGLQRGLPRACFTFISDDDGRTW
RRSSLVTTPDHQGGGFHDGIRWNHGAAEPTVIELKDGRLWMIIRTSQDHHYQSFSDDGGE
TWSDATPSPFYGTITMPTIGRLQDGRILFLWSNTTPLPEVNNTNGVWDDVFTNRNVIHAA
ISSDDGKSWQGFRELYLDPRRNAEDFGTIPGIDKSVHQSQFIEVDPGEVLVSLGQHPLHR
VMLRFNVDWLYENERFCDFSDGLDQWSVFNYYKGIVGHCGYNRIPGCTLEDGKLLVKYIE
DDTLLTSVRGAVWNFPAFHKGKLSLSIKFNDLNSQGELILNDRWFNPTDTTASYFAPFSL
KLNTKILKIRDTNPHLIEIEWDLNKTRPAAIVYVDKRKRLSLPLSDESLHGISYLQLLSD
RVKGDKGYLIEWVKAEKL

Enzyme Prediction     

No EC number prediction in MGYG000001503_01962.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	64	313	1.3e-25	0.5409356725146199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.90e-24	69	319	113	303	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	9.73e-16	71	310	84	252	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	8.69e-08	173	352	52	215	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA17103.1	0.0	1	558	1	558
QRX64725.1	0.0	28	558	29	559
ADV43976.1	6.27e-251	34	557	19	542
CAH08632.1	7.53e-241	22	556	23	562
QCT79443.1	7.53e-241	22	556	23	562

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000338	0.998948	0.000206	0.000177	0.000167	0.000145

TMHMM  Annotations     

start	end
7	26