CAZyme Information: MGYG000001485_03084

Basic Information

• Species: Pseudomonas_E massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E massiliensis
• CAZyme ID: MGYG000001485_03084
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1192	MGYG000001485_7|CGC15	131310.61	5.9592

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001485	4723534	Isolate	not provided	not provided

• Gene Location: Start: 975668; End: 979246 Strand: +

Full Sequence      

MTSTPLVSIAVLVQDATHFYRALHSALGQNYPALEVIVSDSSGDPEVARLVKEAQASSTV
SLRYHAHAKPLRYPADVQWALEQAKGVYVKFLHSEDWLLPTLVARQAQVLDAYPDAGMCS
AQRWFADPDGVLLPVRVENFSLITDDSLLKGGDLLAFFEAWPINFIGSLSATLLRRNYLK
RVVPALVDAESELQVDFDLALYVSVLRHGHLAVIAQTLCAERLEPLRYRGVDVAARHGLE
QAVVVRLIGQLSGERAPWPGSVRVWSLTTPPTPEAERDYTELPLTRLLHIQTLTQNARIG
SSARTFSEMYQQWLASRDFNEGGRALLPERVASWPFQPQIMPVVFARGDQAELDATLASI
EAQSYGACGCLVLSTAQAELEQKGAHVYAPLQADWASQLNELLVQLEGFDWFYLLEAGDT
LAPHALLQLAERIATKEGIQACYSDEDRGADRPQPEPVFKPDFNLDLARAYPYMGRAIAF
SRQGFADAGGLDGGAGEAAAADLVLRMAEQYGLGSIQHLPDVLLHAKALPYAGWLALGSV
AEGHNYSLAGHLARLGQAFEWRAAQVGDFLRVRYVHETRPLVSILILASDDTARLQACLD
SLLEKTQYEHYEVLIGVEASAPQATQHWLHALQGIAQGRIRVVEQADGQVRGERYNGLAR
QARGEYLLTLSADCRIIEGAWLDELLAIGQRPEVGITGAKLLGPDGRIEHAGLILGLRGI
AGSPFLGEAPTARGYLQRLVVPQNYSAVSQHCMLIRRSLFEQLGGLTTDVLGEHCPHIEF
CLRAADVGTLTVWTPDAVLGYRSAPDNTAQLRPGYDRAMAEAYRRWMPRLVKDPAYNPNL
TLGGSSFGLEAGLHGAWQPFESRLRPHLLCLPINPGAVGHYRLIQPFHEVERAGLATGLV
YHGVPSLAEVGRIQPDSVIFQGRYSLRAAEGIESFKRYSPAFRVYELDDYLLDVPGANEH
KRFLAKDIQSSLRYSVGLCDRLVVSTQTLAEVMADMIDDIRVVPNMLPPQRWAHLQGKRR
GEVKPRVGWGGGTSHTGDLLLIKDVVKALANEVHWVFFGMCPEELRPYVHEYHGSVPLED
YPAKLASLDLDLAIAPLEQHIFNDCKSNLRLLEYGACGFPVVCTETRSYRGSLPVTLVSS
NGTEEWIAAIRSHLADPEASAAQGLALREAIHRDFMLHGPALGRWLEAWTPG

Enzyme Prediction     

No EC number prediction in MGYG000001485_03084.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	3.24e-14	973	1175	158	381	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd04184	GT2_RfbC_Mx_like	2.07e-13	340	482	6	158	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	6.83e-13	595	799	12	162	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.75e-10	21	126	14	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1216	GT2	1.74e-09	578	799	1	217	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBP78585.1	0.0	1	1189	1	1195
QQZ43629.1	0.0	1	1191	1	1189
QXI02041.1	0.0	1	1191	1	1185
AZC17065.1	0.0	1	1189	1	1182
AUG00995.1	0.0	1	1191	1	1189

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.15e-56	290	851	326	899	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	5.89e-53	310	850	293	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001485_03084.