CAZyme Information: MGYG000001481_03591

Basic Information

• Species: Neobacillus sp000821085
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus sp000821085
• CAZyme ID: MGYG000001481_03591
• CAZy Family: GH101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1810	MGYG000001481_1|CGC29	200957.86	4.7144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001481	4702581	Isolate	not provided	not provided

• Gene Location: Start: 3548737; End: 3554169 Strand: -

Full Sequence      

MKIKGKKLLAMLLVFILAVPSLPTNLLASAALNTADEIYTEDFSSQDLTGWEKDLGAGRF
EVVNGQLEMETDGWVAGSIDYQQYYNTKAPKLKNARLAMDISVKNTAGRFAVVYRHIDAQ
NYDYIGYDIGGKWIRAEVRNGKKIDKELPVNLNVDNKKFRFSMKYVNENIEVYVDDTQLY
NGPHTDNDAGYFGLRTWGYTGNYAFIQVDNIEYEKIRENEKTEDGHYLVSFKDEDHTGGW
GKVAGNGTMAYTDQAMNFAANGNTIYADAYSPNLKNGFVEYEVTPKSSGRMGFLFRFNGA
NDFAGFGYDVGGVWNFITGDDKWGQVGNKALKIGEKNTVRIEFINDNYRLTVNNDEVFNG
PINAFSTKSGKAGLRTWGYGSGDTQGQLDLHKMVMGEFAGVTLTPNSMTVRSGDAGLYDI
NIKISETTNELSKITHEGRVLEAGTEYVLNETSTILTLKKEFIQSLQQETDTKTKVILEY
KDGFKAEFPITVLGTPQASEELYVKDFSNDINGINKVNGTGEVGHNKGLDITNGQNLIVI
DENAPTYKNTEVEFMFDPKNDSGNFGIVLRYNGPDDWLALGQNGSGANSTSWNLFSPGGQ
NKQLTQDGNRIYAKRMKPYKVKARIVENVATIYLDNAEIYTGEVSGVSNKAGKVGLRYYG
GSGANVSYLSVKEAKFPTRVTNKVDSVEIKSADLTVNVDTDFPTINHYILGGETITGQAN
KVHEVEVNNTMYTPEVTSVVNENKITYSMKIKEIGVSFDVVLTVENNVLDFRIKNIKDEG
QMIYTINFPEHSLVSMESNKENAKLTVNNYREQKNIKLSEAGIADAFQETSIAVLSSDKI
AASISNGSIKRRNEVAYQTFVQDGYRSTGIWTNEYLYRGLDNEVIEEPWTKVAITLDRNG
DAIVDAIDGAIAYRDDIARKVVGSDTVMRSYNSIAMNVGSNAQYPFLRILDNIKKFNLGT
DGFNQNVVVKGYQTEGHDASTGDFNNFSERAGGLEDLLVLLENAKGNNATVGVHINQTEI
YPESKHYGDYIASSVPGWSWYDSAYQIIRENDILIENQGMLERLQDLNESTKGLLEMIYV
DVFFDTRWPAHEMAEAVNDKLGMALGTEYVDEFTKDSVWAHHIDNRFNAAGNLIRVIHNN
DKDIFGNQALFRDASTRNVGINGWQNSVDFNKSTREFFTQVLPNKYLAQYPIMNYETTNK
AVLGKDRNVVTEIINGVNHISQDGKKVAEGNKIFIPWTNDGEEEKIYAWSDDGAEKTWDL
PNGWEGETEVKLFKLSDQGRKLIETIIVNDGKITIDLDKGTGYTIYKGSVSVDEKSSVDV
DWTQGSVVKDAGFNSHAFKDWKKESGSAEFQNNTIGNTHMIINGEEKGIVSQELTGLEVG
ESYGASVWTLVENGKRAIIRITDGDHVYENYIDKSDVKYGVHHTDKYRTNTQRMGVSFIA
QNDTVLLELIGEESGADGKVDFDDVRVRKIGLSDQKGHTFLEDFENVDEGFGPFISTESD
NSHLSEANKPYTKDTIDGRYSLKIRYGDHMRTLPQTMRLKANTEYKLSIDYIAYQDGIFN
ASIKTDDGNETLITKPAVKHPDGENPGTINLEFTTGDYNDYYLDISPRNSGQGEYILDNL
ILDEMAGEADITALEKKIAEVEGLDETAYTEESWKPFAEALAAARIIASKADATKNEVDE
ALKALNAAHEGLEKVEEPTDPTDPADKTKLEKKIAKFEGLDGKAYTEESWIKFAAALAAA
KDIASKADATQNEVDEALKALKVAHAGLKKAKKPTAPSKPGKPSEPGKPGKPSESGKPSE
PGKPGKMVFG

Enzyme Prediction     

No EC number prediction in MGYG000001481_03591.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	692	1208	6.4e-94	0.8076379066478077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14244	GH_101_like	3.07e-77	925	1197	6	298	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam12905	Glyco_hydro_101	5.49e-61	908	1171	2	270	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
pfam18080	Gal_mutarotas_3	1.62e-51	689	905	1	242	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	5.94e-21	1180	1280	1	110	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.
pfam17974	GalBD_like	4.15e-11	1463	1599	1	162	Galactose-binding domain-like. Proteins containing a galactose-binding domain-like fold can be found in several different protein families, in both eukaryotes and prokaryotes. The common function of these domains is to bind to specific ligands, such as cell-surface-attached carbohydrate substrates for galactose oxidase and sialidase, phospholipids on the outer side of the mammalian cell membrane for coagulation factor Va, membrane-anchored ephrin for the Eph family of receptor tyrosine kinases, and a complex of broken single-stranded DNA and DNA polymerase beta for XRCC1. The structure of the galactose-binding domain-like members consists of a beta-sandwich, in which the strands making up the sheets exhibit a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD58436.1	0.0	1	1681	1	1681
ATD54117.1	0.0	1	1681	1	1681
QBJ76357.1	0.0	1	1681	1	1681
SLK22612.1	0.0	1	1681	1	1681
BBK22105.1	0.0	228	1683	38	1528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZXQ_A	1.15e-89	679	1681	17	1191	Crystalstructure of endo-alpha-N-acetylgalactosaminidase from Bifidobacterium longum (EngBF) [Bifidobacterium longum]
6QEP_A	2.27e-89	684	1681	7	1176	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
6QFK_A	5.49e-89	689	1681	12	1176	EngBFDARPin Fusion 4b G10 [Bifidobacterium longum]
6QEV_B	5.49e-89	689	1681	12	1176	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
6SH9_B	5.49e-89	689	1681	12	1176	EngBFDARPin Fusion 4b D12 [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9WNA0	8.30e-96	687	1633	50	1045	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
Q2MGH6	6.15e-86	682	1559	327	1328	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
Q8DR60	2.45e-85	682	1559	327	1328	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000422	0.998699	0.000249	0.000229	0.000200	0.000180

TMHMM  Annotations     

start	end
9	31