CAZyme Information: MGYG000001477_02201

Basic Information

• Species: Clostridium_L amazonitimonense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_L; Clostridium_L amazonitimonense
• CAZyme ID: MGYG000001477_02201
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		36867.21	9.1992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001477	3750216	Isolate	not provided	not provided

• Gene Location: Start: 1445550; End: 1446506 Strand: -

Full Sequence      

MTIKKKVTISLIMILILSSSICFLLYKRNYNLKYKNINFKSMKVIDYIKSADEASKGKLQ
VNWKQMAALDAVRYKNNLSESTEESRLDLANMFLEENKGEFKVKNSNYSIISMDEVMTKL
EFKEKEKERANKYLKDLEYRGLLKEELDKDSVQTDFINSIKEGAIEGYTRYGIFPSVTIA
QAILESGWGKSDLTVKANNLFGIKADKGWKGEKVSMKTSEYNNQIITDNFRVYKSINDSI
TDHREFLYNNPRYSKAGVFQATHYIEQAQAIEKGGYSTVENHKGEKVYSDLLITLIRDYN
LQLVDYEVEMKYLKGEIR

Enzyme Prediction     

No EC number prediction in MGYG000001477_02201.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	163	301	4.6e-36	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.41e-46	150	305	40	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.32e-32	155	301	162	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	2.90e-32	155	297	154	295	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	5.25e-26	161	243	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	3.49e-24	155	306	10	146	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCZ47704.1	1.45e-108	29	315	33	318
AGF55231.1	2.21e-107	4	315	5	316
AQR94121.1	2.21e-107	4	315	5	316
QUN36556.1	2.44e-107	30	316	34	320
AQS03910.1	3.46e-107	30	316	34	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	4.70e-19	153	305	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3VWO_A	3.59e-16	156	296	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	4.38e-16	156	296	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	3.01e-15	156	296	5	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	2.28e-14	155	282	5	137	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	5.56e-22	145	305	43	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	4.19e-17	156	278	163	290	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	1.04e-16	156	278	164	291	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9CIT4	2.63e-13	156	305	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	4.73e-13	156	305	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.495267	0.016749	0.484311	0.000090	0.000066	0.003515

TMHMM  Annotations     

start	end
7	26