CAZyme Information: MGYG000001469_03536

Basic Information

• Species: Neobacillus jeddahensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Neobacillus; Neobacillus jeddahensis
• CAZyme ID: MGYG000001469_03536
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		39919.49	10.2877

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001469	4762944	Isolate	not provided	not provided

• Gene Location: Start: 29045; End: 30121 Strand: +

Full Sequence      

MEKKTIVFTGGGSAGHVTPNIAIINEIRTEWTISYIGSKKGIEKELIVKIDIPYYGISSG
KLRRYVDVENVIDLFRVIKGCVEARRILKRVKPDLVFSKGGFVSVPVILAARSLHIPIFI
HESDMTPGLANKISQRFATKIFTSFEETKKFFPKSKTMAIGSPIRREVLMGSKEKGRRFL
DFHQGRPILTIMGGSLGAKKINEVVRTALPQLRATYQIVHLCGKNNVDSSLSSLPGYRQF
EYVHEELPDILAATNIVITRGGSNSIFEFLALKIPMLIIPLSLQQSRGDQIVNAKAFEKE
GFSQTLAEEDLTSESLIKYVGKVEKTSDMIRSKMNASQQTNGLQVLVDEINRMGKNTN

Enzyme Prediction     

No EC number prediction in MGYG000001469_03536.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	189	339	2.2e-37	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	2.98e-150	4	351	2	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	3.02e-132	3	350	1	351	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.98e-112	6	320	2	318	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	9.34e-105	4	350	1	351	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	2.25e-93	4	339	1	334	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIM17034.1	3.20e-195	1	352	1	352
QQX25793.1	8.62e-184	1	352	1	353
QQZ08635.1	8.62e-184	1	352	1	353
QQZ04180.1	2.12e-177	1	354	1	355
QKE72585.1	1.84e-173	1	353	1	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	1.18e-36	2	353	8	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	6.12e-34	2	355	5	355	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	8.48e-32	3	332	2	330	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q730T5	9.83e-143	4	350	2	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=murG2 PE=3 SV=1
Q812T8	8.00e-142	4	350	2	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=murG2 PE=3 SV=1
Q6HDR3	1.14e-141	4	350	2	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=murG2 PE=3 SV=1
Q81JE6	1.61e-141	4	350	2	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 2 OS=Bacillus anthracis OX=1392 GN=murG2 PE=3 SV=1
A0RIN0	2.28e-141	4	350	2	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 3 OS=Bacillus thuringiensis (strain Al Hakam) OX=412694 GN=murG3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001469_03536.