CAZyme Information: MGYG000001464_00480

Basic Information

• Species: Fusobacterium polymorphum
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium polymorphum
• CAZyme ID: MGYG000001464_00480
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000001464_1|CGC3	37689.09	8.2563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001464	2566364	Isolate	not provided	not provided

• Gene Location: Start: 528940; End: 529887 Strand: +

Full Sequence      

MINIRKYILLLFFSIVCFSFSATNNVYKERMRDFIKELRNNTNKEKIIITQNGNELYFKN
GKIDNKFFALTDGTTQESLYYGDILRFNVPTAKGLKNELLELTIPIRKKGKPVFIINYGK
GQKKREFLKKEDLKTKFVSELLPSFNADKLYETIEDYNDEDINSLSDVKNFLCLLNPENF
SDIDEYYQALRNTNYDLLLIEVSYNNIFFTKEQIEELKIKDNGGKRIVIAYLSIGEAENY
RFYWKKKWNKKKPKWIIKENENWEGNYIVKYWSPEWKNIIKEYQKKLDEIGVDGYLLDTV
DSYQYFEENYKNTLE

Enzyme Prediction     

No EC number prediction in MGYG000001464_00480.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	209	309	1e-18	0.4107142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2342	COG2342	9.43e-61	136	313	1	161	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
TIGR01370	TIGR01370	5.64e-23	181	312	55	181	extracellular protein. Original assignment of this protein family as cysteinyl-tRNA synthetase is controversial, supported by but challenged by and by subsequent discovery of the actual mechanism for synthesizing Cys-tRNA in species where a direct Cys--tRNA ligase was not found. Lingering legacy annotations of members of this family probably should be removed. Evidence against the role includes a signal peptide. This family as been renamed "extracellular protein" to facilitate correction. Members of this family occur in Deinococcus radiodurans (bacterial) and Methanococcus jannaschii (archaeal). A number of homologous but more distantly related proteins are annotated as alpha-1,4 polygalactosaminidases. The function remains unknown. [Unknown function, General]
pfam03537	Glyco_hydro_114	3.12e-11	210	304	28	113	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJX51619.1	3.98e-225	5	315	2	312
CKH07121.1	8.98e-225	1	315	1	315
QYR56087.1	6.60e-224	5	315	2	312
QYR60214.1	1.05e-220	5	315	2	312
QNE69464.1	1.60e-215	5	315	2	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2AAM_A	1.08e-22	180	308	17	152	Crystalstructure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_B Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_C Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_D Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_E Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_F Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58872	6.72e-30	158	309	53	201	Uncharacterized protein MJ1477 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1477 PE=4 SV=1
Q9X1D0	7.29e-22	180	308	31	166	Uncharacterized protein TM_1410 OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=TM_1410 PE=1 SV=1
Q9RWG3	9.12e-16	226	304	100	178	Uncharacterized protein DR_0705 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=DR_0705 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.025969	0.950181	0.022931	0.000307	0.000277	0.000295

TMHMM  Annotations     

start	end
7	26