CAZyme Information: MGYG000001463_00737

Basic Information

• Species: Helicobacter_B canis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_B; Helicobacter_B canis
• CAZyme ID: MGYG000001463_00737
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		44018.48	9.1527

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001463	1924985	Isolate	not provided	not provided

• Gene Location: Start: 772470; End: 773675 Strand: +

Full Sequence      

MIVITGGGTGGHLAIARALAQELHKREIPAIYIGSLYGQDQMWFGQKLESSGLDSSLASK
SSELFQECYFLNTSGVVNKKGFKKLASIYAQLRAMWGVRKIFARHGVQAVISVGGFSAGP
ASLAAIMLRKPLFIHEQNAIQGRLNSLLAPFAKAVFNSFHPPFPPYPIKQEALQSRRIRT
EFQSIIFIGGSQGAKAINDLALQAAPKLLARGIRIIHQCGERDLDRVRQAYMELDSSLLE
SRESAELESKRLDSSSAQEPSSAPRLTLFSFDKDLIKHLDKADICIARAGASSIWENAAL
SLPTIYIPYPYAANNHQYHNASYFTRQGLGLMITEQELRKLDSSPKESLESALDLAKFFA
LLSQLESNLTEISTALSQTITTNGAELIITDIMQTLAGKQT

Enzyme Prediction     

No EC number prediction in MGYG000001463_00737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	185	342	2.1e-38	0.8089171974522293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	5.64e-95	12	399	14	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	3.77e-80	12	389	12	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	4.28e-80	12	392	13	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	9.01e-68	12	399	13	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	1.08e-30	185	354	2	138	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP77524.1	5.65e-109	1	392	1	344
BCD70261.1	1.27e-107	1	396	1	353
BCD50740.1	1.27e-107	1	396	1	353
BCD48956.1	1.27e-107	1	396	1	353
BCD45547.1	1.02e-106	1	396	1	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	4.84e-30	2	328	12	311	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	5.48e-27	2	336	5	307	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	2.17e-24	2	338	9	310	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7U322	1.13e-109	1	392	1	344	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) OX=235279 GN=murG PE=3 SV=1
Q17WB5	1.61e-99	2	393	3	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter acinonychis (strain Sheeba) OX=382638 GN=murG PE=3 SV=1
B5Z8F1	1.17e-96	4	393	5	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain G27) OX=563041 GN=murG PE=3 SV=1
Q1CSB1	2.35e-96	4	393	5	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain HPAG1) OX=357544 GN=murG PE=3 SV=1
Q9ZK59	6.65e-96	4	393	5	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001463_00737.