CAZyme Information: MGYG000001463_00180

Basic Information

• Species: Helicobacter_B canis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_B; Helicobacter_B canis
• CAZyme ID: MGYG000001463_00180
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483		53808.96	9.2124

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001463	1924985	Isolate	not provided	not provided

• Gene Location: Start: 200342; End: 201793 Strand: +

Full Sequence      

MPLLLYLSIKPKYRRSIPARFFPFLRSLMPKSSGFCKDFSPHIWLHACSFGEIKSLAPII
QALANHKRRILLTTTTQTGFDLAQSTYASEPTIRVEFLPFEIFLPFYRHRLQELQSLIVT
EAELWLGLFSTAKTLGAQTLLINARISTRSYPKYRRFRFFYRVLFSCVDRVFAQSQADKD
RLSTLGAHHIEVLGNLKLLSPIATSATYPKPSNRLVIVAASTHQGEEELVLQAFSALKKL
ESSKMDSVLGRHSPDCPYFRAVTTDKVAPTPKYGQSKQSPTATPRILEEDNHALCEKSPK
QKANATGEKMDSSPQAESPKTQKVDSSLLILAPRHPERFDEVATQLASYPFASARFTQGA
QVLNDSRLDVVLLDTLGELNNCYAIADIVILGGAFIQAGGHNPLEPAFFHTKLISGKAIF
NQEALFACIDGYTLCEASELEATLLAHQSLPKAAYKPMPIDLPSLVHIITHPKQSPQHKD
NNG

Enzyme Prediction     

No EC number prediction in MGYG000001463_00180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	37	198	6.9e-46	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	8.33e-124	2	454	19	392	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	3.03e-93	2	427	18	359	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	4.27e-49	41	197	14	173	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBG40598.1	8.04e-105	1	466	18	386
SQH72095.1	8.04e-105	1	466	18	386
AAP77237.1	2.76e-101	1	456	34	403
CBY83042.1	5.65e-100	1	451	10	360
BAM31522.1	2.64e-99	1	456	7	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	1.59e-15	22	416	24	308	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	1.02e-09	330	425	75	169	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44806	6.12e-29	7	426	24	361	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
Q8R6G8	5.92e-28	13	417	13	341	Bifunctional glycosyltransferase/methyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) OX=190304 GN=trmB PE=3 SV=1
Q45374	4.07e-26	43	421	55	361	3-deoxy-D-manno-octulosonic acid transferase OS=Bordetella pertussis OX=520 GN=waaA PE=1 SV=1
P0AC76	1.94e-22	43	430	51	363	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P0AC77	1.94e-22	43	430	51	363	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001463_00180.