CAZyme Information: MGYG000001460_00779

Basic Information

• Species: Romboutsia dakarensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Romboutsia; Romboutsia dakarensis
• CAZyme ID: MGYG000001460_00779
• CAZy Family: GH18
• CAZyme Description: Peroxiredoxin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597	MGYG000001460_35|CGC1	67060.25	4.6652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001460	3735762	Isolate	not provided	not provided

• Gene Location: Start: 5635; End: 7428 Strand: -

Full Sequence      

MPNLPSLGSIAPDFRADTTSGPIKLSDYSGKWVVLFSHPGDFTPVCTTEFLCFAKYYPEF
QKRNTELIGLSVDSNSSHLAWIYNIFQLTGVEIPFPIIEDRDMRIAKLYGMISEPMSNTS
TIRSVFIIDDKQVLRTILYYPLTTGRNIPEILRIIEALQTSDRDNVVTPANWFPGMPLIL
PYPKTYKELKHKVSNCDKKYSCLDWYLCFVPDNNSSDNYECINYIPNYPDKNSNLGVLSK
NNTRPPISNIHEQPVDVTFCPDVNPIVMEYVFGNPTNVDPQLSDALIYAFVEINPDGTLF
VPTPNFLRQLINLKAEKPSLKVIAAIGGWGAEGFSDAALTPASRYNFAREAQKLVNQYGL
DGVDIDWEYPGTAAAGIKARPQDKENFTLLLTALRDVLGEDAWLSVAGTGDMGYINRSAE
VDKIAPLIDYFNLMSYDFTAGETGPNAMKHQANLYDSPLSLPGYSVDAMVKNLESSGMPS
EKILLGIPFYGRLGATITRTYDQLRKDYINKNGHEFRFDKDALVPYLVKNGEFSMSYDDA
LSIYFKAQYVLKNCLGGIFSWTSTYDQANILANAMYQSINDPLKVQAEIQKIYDFLD

Enzyme Prediction     

No EC number prediction in MGYG000001460_00779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	276	577	3e-60	0.8885135135135135

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13189	PRK13189	4.46e-115	3	213	7	222	peroxiredoxin; Provisional
cd03016	PRX_1cys	1.35e-111	7	211	1	203	Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.
cd06548	GH18_chitinase	1.64e-89	272	566	15	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
COG0450	AhpC	2.10e-76	7	190	5	192	Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin) [Defense mechanisms].
PRK13190	PRK13190	8.02e-76	7	210	4	201	putative peroxiredoxin; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED94343.1	0.0	1	593	1	585
CEI73471.1	0.0	1	590	1	582
AXU31260.1	0.0	1	593	1	706
AXU27459.1	0.0	1	593	1	706
AXU35048.1	0.0	1	593	1	706

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TSB_AAA	1.26e-195	239	593	10	364	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	2.51e-195	239	593	29	383	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
5OVQ_D	2.18e-78	3	208	5	218	CrystalStructure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_F Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_G Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_H Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_I Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_J Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_L Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5]
5OVQ_A	2.26e-78	3	208	5	218	CrystalStructure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_B Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_C Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_E Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5],5OVQ_K Crystal Structure of the peroxiredoxin (AhpC2) from the Hyperthermophilic bacteria Aquifex aeolicus VF [Aquifex aeolicus VF5]
6Q5V_A	5.92e-61	4	209	6	209	1-CysSiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_B 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_C 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_D 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_E 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_F 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_G 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_H 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_I 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A],6Q5V_J 1-Cys SiPrx, a Prx6-family 1-Cys peroxiredoxin of the thermoacidophilic archaeon Sulfolobus islandicus [Sulfolobus islandicus REY15A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8R844	6.93e-100	4	209	14	218	Peroxiredoxin 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=TTE2186 PE=3 SV=1
O67024	3.93e-79	3	208	5	218	Peroxiredoxin OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_858 PE=1 SV=1
Q8PYP6	9.28e-67	4	212	1	216	Peroxiredoxin OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=MM_0814 PE=3 SV=1
Q979N7	5.12e-63	7	210	5	202	Peroxiredoxin OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TV1123 PE=3 SV=1
A2BJD9	1.29e-62	5	209	6	210	Peroxiredoxin OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) OX=415426 GN=Hbut_0228 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001460_00779.