CAZyme Information: MGYG000001451_03910

Basic Information

• Species: Paenibacillus_A antibioticophila
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A antibioticophila
• CAZyme ID: MGYG000001451_03910
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1326		139408.44	4.5071

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001451	5573040	Isolate	not provided	not provided

• Gene Location: Start: 455001; End: 458981 Strand: +

Full Sequence      

MNSQKRFVAWVCIVALFAGTFLTSIGWPDPARAAGGPNLAAGKAVSASGHADVYVATNAA
DGNAGTYWESTNNVFPQWVQVDLGNTASVDQVVLKLPEGWESRTQTLSVQGSTTGTGFSD
LKASANYTFDPSLGNTVTVDFPATAARYVRIHVTANTGWPAAQLSEVEIYGAAAQPEPSP
IPGKIEAESYSGMNGIQTEPTSDTGGGLNVGWIHAGDWLDYSVNVQSAGTYTLEYRVASN
SATGEIQLQSGGTTLATTAVPNTGGWQNWQTVSATVTLNAGSQTLRVFASGYDFNLNWLQ
FAPGNASDTQAPTAPANLALTQPSSGTIRLTWNASTDNVGVIGYDIYANNQLRGSVNGST
LTYTDSQPASLTVTYHVIAKDAAGNTSAPSNSVTRNGSSGGNETNLAIGKAISASSSTFT
FAAANANDNDVNTYWEGGTHPSTLTVDLGANANVTSVVLKLNPASAWATRTQTIQVLGHD
QNSATFTNLVTAASYTFNPASQNTVTIPVDATASSLQLRITANSGAPGGQIAEFQILGTP
APNPDLTVTGMTWSPGSPNESQNITLDATVQNIGEVASPATSVNFYLGSTLAGTAPVGAL
APGASANVSANIGVKEAGSYSVTAKVDESNTVIETNNANNNYTHPAQLVVGQVQSSDLIG
TVSWTPSNPSAGNTVTFTVNLKNQGTIASAGGAHGVTVVLKNAAGSTVQTLNDSYSGSLA
AGASANLTLGTWTAVNGSYTVMVTVATDANEVPAKQANNVSTSSLYSGRGANMPFTILEA
EAPGNSTYGTKLAPNFTPGDFAGEASGRSAVYLDATGEYVEFTLTSPANAFVLRNAVDEN
TTGTISIYADGVDKGNFTVTSKFSYVYATPSTLGRLGYDNSGSKAYWLYEDAQLMLDQVY
PAGTKIKIQKDAGDVPWIYVDMIETENVAPPASNPDPSKYVEVSSTKSIEQALNEFRQDP
SKKGIFIPAGEWTLTSKIYLYGRATEIIGAGPWHTKLVAPQNQTNTDIGFNISSQANGST
IKDLSAWGNYVYRQDGPGKFIDGNGMQNVTIENIWAEHFICLYWGVNSSHNTFKNNRIKN
VFADGINMTNGSSYNIIDNNYARGTGDDAFALFSAIDAGGSYNVGNKYTNLTATNVRRAA
AFAIYGGKDNLFQNLYGADTLTYPGLTVSSLSFGYNTLGFGDQDTVIDGVTLDRTGGDFW
TSVGADDKINEYQNFGAIWLHGGDRDFKNILIKNVDINQPVYFGIMFQSKSPENVQMQNI
RLENITINNPSRYGIKLVAKAEDGQGPVVGSASFSNVIIHNPGVAAIYGENKSPGFTVIR
GSGNNW

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	398	1307	6.3e-173	0.9731993299832495
CBM6	186	301	1.3e-35	0.855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	2.67e-51	770	925	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
cd04080	CBM6_cellulase-like	3.69e-46	181	301	1	143	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
smart00606	CBD_IV	3.51e-36	181	301	4	129	Cellulose Binding Domain Type IV.
pfam03422	CBM_6	5.82e-32	186	301	1	123	Carbohydrate binding module (family 6).
cd04084	CBM6_xylanase-like	7.95e-25	184	301	2	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANS76644.1	0.0	1	1326	4	1330
QMV42812.1	0.0	1	1326	4	1328
QTH42681.1	0.0	2	1326	5	1328
AYQ75762.1	0.0	19	1326	4	1309
AZS18146.1	0.0	13	1326	1	1316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K0S_A	0.0	757	1326	1	573	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
6K0P_A	0.0	757	1326	1	573	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0Q_A	0.0	757	1326	1	573	Catalyticdomain of GH87 alpha-1,3-glucanase D1068A in complex with nigerose [Paenibacillus glycanilyticus],6K0U_A Catalytic domain of GH87 alpha-1,3-glucanase D1068A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
6K0M_A	0.0	757	1326	1	573	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
7C7D_A	1.80e-38	770	1325	54	576	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27082	7.32e-19	185	300	413	531	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
P20533	5.13e-15	308	394	556	641	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
A0P8X0	1.29e-08	308	394	811	896	Alpha-amylase OS=Niallia circulans OX=1397 GN=igtZ PE=1 SV=1
P27050	4.28e-08	308	400	89	180	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
P50401	8.80e-07	308	390	478	559	Exoglucanase A OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000337	0.998870	0.000217	0.000223	0.000174	0.000146

TMHMM  Annotations     

start	end
7	29