CAZyme Information: MGYG000001447_01441

Basic Information

• Species: Prevotella oralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oralis
• CAZyme ID: MGYG000001447_01441
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264	MGYG000001447_2|CGC5	30787.66	9.1715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001447	2849145	Isolate	not provided	not provided

• Gene Location: Start: 397358; End: 398152 Strand: +

Full Sequence      

MILVKGYGQMCNNILQFAHLYAFGREYGIKVISMRFSYKFRYFAVCKKWYHNPLTYFIGK
LLVSAHVIDCITEDNTPATDRRLRETKLIACSAWGCRYPALFQKYREEIRQLFEIKPTIK
EKISIKMAAHPHADISLGLHIRRGDYRYWQGGKYFFDDNVYHKIIKQFCALHTGKTINIY
ICTNDQKLNIDDFRAIHPTTYLSNGSGIEDLQLLASCDYIIGVKSTFSLWASFYNNVPLY
WIMDKDAPLTIGAFTHFNNVYTSV

Enzyme Prediction     

No EC number prediction in MGYG000001447_01441.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	239	3.3e-24	0.8876811594202898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	2.60e-14	1	236	1	242	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	2.66e-10	91	235	115	266	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	4.53e-08	91	233	120	279	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam05830	NodZ	2.27e-04	90	234	128	294	Nodulation protein Z (NodZ). The nodulation genes of Rhizobia are regulated by the nodD gene product in response to host-produced flavonoids and appear to encode enzymes involved in the production of a lipo-chitose signal molecule required for infection and nodule formation. NodZ is required for the addition of a 2-O-methylfucose residue to the terminal reducing N-acetylglucosamine of the nodulation signal. This substitution is essential for the biological activity of this molecule. Mutations in nodZ result in defective nodulation. nodZ represents a unique nodulation gene that is not under the control of NodD and yet is essential for the synthesis of an active nodulation signal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB46427.1	6.99e-137	1	264	1	264
QUT74140.1	4.01e-88	1	264	1	273
QUB63264.1	2.06e-64	1	264	1	270
QUB68171.1	2.91e-64	1	264	1	270
QUB65418.1	2.91e-64	1	264	1	270

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999857	0.000142	0.000010	0.000002	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001447_01441.