CAZyme Information: MGYG000001445_03377

Basic Information

• Species: Cedecea davisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cedecea; Cedecea davisae
• CAZyme ID: MGYG000001445_03377
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
162	MGYG000001445_1|CGC44	17950.06	10.5027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001445	4852695	Isolate	not provided	not provided

• Gene Location: Start: 3677271; End: 3677759 Strand: -

Full Sequence      

MKCIVFLVLLFLTTSIANADCWKFAAQKSGVEVRLLKSIAQVESGMDPSVVGKNNNGSRD
FGLMQINSTHLGWLGKHGISESMLVKDPCISVLVGAAILKNMVNIYGYGWEAVGAYNAGA
GKNKHRLRMKYARKVWGIYRQSSRENILIPLKDSHRNIALLR

Enzyme Prediction     

No EC number prediction in MGYG000001445_03377.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	28	146	3.2e-22	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	6.02e-59	1	141	1	141	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	3.13e-50	30	141	2	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.09e-28	22	136	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	1.20e-20	2	150	3	154	lytic transglycosylase; Provisional
COG0741	MltE	2.66e-15	25	129	146	250	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX96582.1	2.11e-113	1	162	1	162
QIR27151.1	4.82e-66	18	160	18	160
ANI31719.1	3.60e-54	19	143	12	136
QJU42329.1	3.23e-53	15	139	21	145
AKG72623.1	1.05e-52	14	142	14	142

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	3.97e-11	20	103	2	86	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	1.66e-43	7	141	7	141	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	1.66e-43	7	141	7	141	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	6.72e-43	7	141	7	141	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q07568	2.76e-35	5	158	5	152	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	3.15e-34	5	158	5	152	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999180	0.000153	0.000143	0.000130	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001445_03377.